KEGG   Saccharomyces cerevisiae (budding yeast): YPR128C
Entry
YPR128C           CDS       T00005                                 

Gene name
ANT1
Definition
(RefSeq) Ant1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Mito_carr DUF2700
Other DBs
NCBI-GeneID: 856246
NCBI-ProteinID: NP_015453
SGD: S000006332
UniProt: Q06497
Position
XVI:complement(791218..792204)
AA seq 328 aa
MLTLESALTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDC
MINIFKEKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPI
TPSTIEELVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFTNVIKDIYRENNGDITA
FWKGLRTGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLVT
QPLIVAKAMLQSAGSKFTTFQEALLYLYKNEGLKSLWKGVLPQLTKGVIVQGLLFAFRGE
LTKSLKRLIFLYSSFFLKHNGQRKLAST
NT seq 987 nt   +upstreamnt  +downstreamnt
atgttaactctagagtctgcattaactggcgctgtggcttcggcaatggccaatattgca
gtttatccgctggatttatcgaagacgatcattcagtcacaagtatctccttcttcaagt
gaggatagtaacgaaggtaaagttttgcccaataggagatataagaatgttgtagattgc
atgataaacatattcaaagaaaagggtattttgggtctgtatcaaggtatgacagtcact
acggtggccacatttgtccagaattttgtttatttcttttggtacacatttatcagaaag
tcctacatgaaacataagctgttaggactgcaatcactgaaaaaccgcgatggtcctatc
acaccttctacgattgaagaattggtacttggggtagcagctgccagtatatcgcaactt
tttactagtcccatggctgtggtagctacaagacaacaaacagtccattctgcagagtct
gccaaatttaccaacgttattaaggacatttaccgtgaaaataatggggacataactgct
ttttggaaaggtttaagaacaggtttagcattgacgataaatccttccatcacatatgcc
tcttttcaaagacttaaagaagtttttttccatgaccattccaacgatgctggcagtttg
tcagcagtgcaaaatttcattttgggtgtcctttccaagatgatttcgactctagttacg
caacccttgattgtcgctaaagcaatgcttcaaagcgctggctctaaattcactactttc
caagaagcgctactatacttgtacaaaaatgaagggttaaaatctctttggaagggagtt
cttcctcaattgacaaagggtgtcattgtgcaaggtctgttgtttgctttcagaggagaa
ttgacaaaatctttaaagaggctaatattcttgtactcttcttttttcctaaagcacaac
ggacaacgcaagctggcttccacttga

DBGET integrated database retrieval system