KEGG   Saccharomyces cerevisiae (budding yeast): YPR140WHelp
Entry
YPR140W           CDS       T00005                                 

Gene name
TAZ1
Definition
(RefSeq) lysophosphatidylcholine acyltransferase
  KO
K13511  monolysocardiolipin acyltransferase [EC:2.3.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YPR140W (TAZ1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     YPR140W (TAZ1)
Lipid biosynthesis proteins [BR:sce01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   YPR140W (TAZ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-GeneID: 856262
NCBI-ProteinID: NP_015466
SGD: S000006344
UniProt: Q06510
Position
XVI:814391..815536
Genome map
AA seq 381 aa AA seqDB search
MSFRDVLERGDEFLEAYPRRSPLWRFLSYSTSLLTFGVSKLLLFTCYNVKLNGFEKLETA
LERSKRENRGLMTVMNHMSMVDDPLVWATLPYKLFTSLDNIRWSLGAHNICFQNKFLANF
FSLGQVLSTERFGVGPFQGSIDASIRLLSPDDTLDLEWTPHSEVSSSLKKAYSPPIIRSK
PSWVHVYPEGFVLQLYPPFENSMRYFKWGITRMILEATKPPIVVPIFATGFEKIASEAVT
DSMFRQILPRNFGSEINVTIGDPLNDDLIDRYRKEWTHLVEKYYDPKNPNDLSDELKYGK
EAQDLRSRLAAELRAHVAEIRNEVRKLPREDPRFKSPSWWKRFNTTEGKSDPDVKVIGEN
WAIRRMQKFLPPEGKPKGKDD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttagggatgtcctagaaagaggagatgaatttttagaagcctatcccagaaga
agccccctttggagatttctttcatacagtacatcattactgaccttcggtgtatcaaaa
ctgcttcttttcacatgctataatgtcaaattgaatggttttgaaaaattagaaactgcc
ttggaacgttccaaaagggaaaatagaggccttatgacggtcatgaaccatatgagtatg
gtcgatgatccgttagtttgggcaacactaccatataagttatttacgtctttggacaac
ataagatggtctttgggtgcacataatatttgctttcaaaataaatttctggccaacttt
ttctcacttggccaagtcctttcaacagaaagatttggggtgggcccatttcaaggttct
atagatgcttcaataagattgttaagccctgacgacactttagacttggaatggacccct
cactctgaggtctcttcttcgctaaaaaaagcctactccccgcccataataaggtcgaag
ccatcttgggtccatgtttatccagaaggatttgtactacaattatatccgccttttgaa
aattcgatgaggtattttaaatggggtattaccagaatgatcctagaagcaacaaagccg
cccattgtagtaccaatatttgctacagggtttgaaaaaatagcatccgaagcagtcaca
gattcaatgtttagacaaattctaccaagaaactttggctctgaaataaatgttaccata
ggggatcctttaaatgatgatttaatcgacaggtatagaaaagaatggacacatttggtt
gaaaaatactatgatcccaaaaatcctaacgacctctctgacgaattgaaatatggtaaa
gaggcgcaagatttaagaagcagattagccgctgaactgagagcccatgttgctgaaatt
agaaatgaagttcgcaaattaccacgcgaagaccctaggttcaaatccccctcatggtgg
aagcggttcaacaccacggaaggtaaatcggacccagatgttaaagtcattggcgaaaat
tgggcaataaggaggatgcaaaagtttctgcctccagagggtaaaccaaagggtaaggat
gattga

DBGET integrated database retrieval system