KEGG   Saccharomyces cerevisiae (budding yeast): YPR158C-C
Entry
YPR158C-C         CDS       T00005                                 
Name
(RefSeq) gag protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: TYA Retrotran_gag_2
Other DBs
NCBI-GeneID: 856285
NCBI-ProteinID: NP_058196
SGD: S000007361
UniProt: Q6Q5H1
Position
XVI:complement(854935..856257)
AA seq 440 aa
MESQQLSNYSPISHGSACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPAS
SAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPM
YFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDI
LSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNN
GIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNY
RRNLSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKS
TTEPIQLNNKHDLHLRPGTY
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggaatcccaacaattatctaattattcacccatttctcatggtagcgcctgtgcttcg
gttacttctaaggaagtccacacaaatcaagatccgttagacgtttcagcttccaaaaca
gaagaatgtgagaaggcttctactaaggctaactctcaacagacaacaacacctgcttca
tcagctgttccagagaacccccatcatgcctctcctcaacctgcttcagtaccacctcca
cagaatgggccgtacccacagcagtgcatgatgacccaaaaccaagccaatccatctggt
tggtcattttacggacacccatctatgattccgtatacaccttatcaaatgtcgcctatg
tactttccacctgggccacaatcacagtttccgcagtatccatcatcagttggaacgcct
ctgagcactccatcacctgagtcaggtaatacatttactgattcatcctcagcagactct
gatatgacatccactaaaaaatatgtcagaccaccaccaatgttaacctcacctaatgac
tttccaaattgggttaaaacatacatcaaatttttacaaaactcgaatctcggtggtatt
attccgacagtaaacggaaaacccgtacgtcagatcactgatgatgaactcaccttcttg
tataacacttttcaaatatttgctccctctcaattcctacctacctgggtcaaagacatc
ctatccgttgattatacggatatcatgaaaattctttccaaaagtattgaaaaaatgcaa
tctgatacccaagaggcaaacgacattgtgaccctggcaaatttgcaatataatggcagt
acacctgcagatgcatttgaaacaaaagtcacaaacattatcgacagactgaacaataat
ggcattcatatcaataacaaggtcgcatgccaattaattatgagaggtctatctggcgaa
tataaatttttacgctacacacgtcatcgacatctaaatatgacagtcgctgaactgttc
ttagatatccatgctatttatgaagaacaacagggatcgagaaacagcaaacctaattac
aggagaaatctgagtgatgagaagaatgattctcgcagctatacgaatacaaccaaaccc
aaagttatagctcggaatcctcaaaaaacaaataattcgaaatcgaaaacagccagggct
cacaatgtatccacatctaataactctcccagcacggacaacgattccatcagtaaatca
actactgaaccgattcaattgaacaataagcacgaccttcaccttaggccaggaacttac
tga

DBGET integrated database retrieval system