KEGG   Saccharomyces cerevisiae (budding yeast): YPR160W
Entry
YPR160W           CDS       T00005                                 

Gene name
GPH1
Definition
(RefSeq) glycogen phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00500  Starch and sucrose metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Module
sce_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YPR160W (GPH1)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     YPR160W (GPH1)
SSDB
Motif
Pfam: Phosphorylase
Other DBs
NCBI-GeneID: 856289
NCBI-ProteinID: NP_015486
SGD: S000006364
UniProt: P06738
Structure
PDB: 
1YGP

Position
XVI:861306..864014
AA seq 902 aa
MPPASTSTTNDMITEEPTSPHQIPRLTRRLTGFLPQEIKSIDTMIPLKSRALWNKHQVKK
FNKAEDFQDRFIDHVETTLARSLYNCDDMAAYEAASMSIRDNLVIDWNKTQQKFTTRDPK
RVYYLSLEFLMGRALDNALINMKIEDPEDPAASKGKPREMIKGALDDLGFKLEDVLDQEP
DAGLGNGGLGRLAACFVDSMATEGIPAWGYGLRYEYGIFAQKIIDGYQVETPDYWLNSGN
PWEIERNEVQIPVTFYGYVDRPEGGKTTLSASQWIGGERVLAVAYDFPVPGFKTSNVNNL
RLWQARPTTEFDFAKFNNGDYKNSVAQQQRAESITAVLYPNDNFAQGKELRLKQQYFWCA
ASLHDILRRFKKSKRPWTEFPDQVAIQLNDTHPTLAIVELQRVLVDLEKLDWHEAWDIVT
KTFAYTNHTVMQEALEKWPVGLFGHLLPRHLEIIYDINWFFLQDVAKKFPKDVDLLSRIS
IIEENSPERQIRMAFLAIVGSHKVNGVAELHSELIKTTIFKDFVKFYGPSKFVNVTNGIT
PRRWLKQANPSLAKLISETLNDPTEEYLLDMAKLTQLGKYVEDKEFLKKWNQVKLNNKIR
LVDLIKKENDGVDIINREYLDDTLFDMQVKRIHEYKRQQLNVFGIIYRYLAMKNMLKNGA
SIEEVAKKYPRKVSIFGGKSAPGYYMAKLIIKLINCVADIVNNDESIEHLLKVVFVADYN
VSKAEIIIPASDLSEHISTAGTEASGTSNMKFVMNGGLIIGTVDGANVEITREIGEDNVF
LFGNLSENVEELRYNHQYHPQDLPSSLDSVLSYIESGQFSPENPNEFKPLVDSIKYHGDY
YLVSDDFESYLATHELVDQEFHNQRSEWLKKSVLSVANVGFFSSDRCIEEYSDTIWNVEP
VT
NT seq 2709 nt   +upstreamnt  +downstreamnt
atgccgccagctagtactagtactaccaatgatatgataaccgaagaacctacttctcca
caccaaatcccaaggcttacaaggagacttacggggtttcttccccaagaaatcaagtca
attgacacgatgattcctttaaagtcaagagcgttatggaataagcatcaagtcaaaaaa
tttaacaaggcagaagattttcaagatagattcattgaccatgtggaaactacattagca
cgttccctatataattgtgatgacatggctgcttatgaagctgcttcgatgagtattcgt
gacaatttggtcattgactggaacaaaactcagcagaaattcaccacaagagacccaaag
agagtttactatttgtctttggagtttttgatgggtagggctttggataatgccctgatt
aatatgaagattgaagatccggaagaccctgctgcctcaaagggaaaaccaagagaaatg
attaaaggggctttggatgatttaggtttcaagttagaggatgtcttggaccaagaaccg
gacgcaggtttaggtaatggtggtctaggtcgtcttgcagcttgcttcgtcgactcaatg
gcaacggaaggcatccctgcctggggttatggtctacgttatgagtatggtatctttgct
caaaagattattgacggttaccaggtggaaactccagattactggttaaattctggtaat
ccatgggaaattgaacgtaacgaagtgcaaattcctgtcaccttttatggttatgttgat
agaccagaaggcggtaaaactacactgagtgcgtcacaatggatcggtggggaaagagtt
cttgctgtcgcgtatgatttcccagttccgggtttcaagacttccaatgtaaataactta
agactatggcaagcaaggccaacaacagaatttgattttgcaaaattcaataatggtgac
tataaaaactctgtggctcagcaacaacgcgcagagtctataaccgctgtgttgtatcca
aacgataactttgctcaaggtaaggagttgaggttgaaacagcagtacttctggtgtgct
gcatccttacacgacatcttaagaagattcaaaaaatccaagaggccatggactgaattt
cctgaccaagtggctattcagttgaatgatactcatccaactttagccatcgttgaatta
cagagagttttggtcgatctagaaaaactagattggcacgaggcttgggacatcgtgacc
aagacttttgcttatactaaccacactgttatgcaagaggccctggaaaaatggcccgtc
ggcctctttggccatttgctacccagacatttggaaattatatatgatatcaactggttc
ttcttgcaagatgtggccaaaaaattccccaaggatgttgatcttttgtctcgtatatcc
atcatcgaagaaaactctccagaaagacagatcagaatggcctttttggctattgttggt
tcacacaaggttaatggtgttgctgaattgcactctgaattaatcaaaacgaccatattt
aaagattttgtcaagttctatggtccatcaaagtttgtcaatgtcactaacggtatcaca
ccaaggagatggttgaagcaagctaacccttcattggctaaactgatcagtgaaaccctt
aacgatccaacagaggagtatttgttggacatggccaaactgacccagttgggaaaatat
gttgaagataaggagtttttgaaaaaatggaaccaagtcaagcttaataataagatcaga
ttagtagatttaatcaaaaaggaaaatgatggagtagacatcattaacagagagtatttg
gacgacaccttgtttgatatgcaagttaaacgtattcatgaatataagcgtcaacagcta
aacgtctttggtattatataccgttacctggcaatgaagaatatgctgaagaacggtgct
tcgatcgaagaagttgccaagaaatatccacgcaaggtttcaatctttggtggtaagagt
gctcctggttactacatggctaagctgatcataaaattgatcaactgtgttgctgacatt
gttaataacgacgagtcaattgagcatttgttgaaggttgtctttgttgctgattataat
gtttctaaggctgaaatcattattccagcaagtgacttgagtgagcatatttctactgct
ggtactgaagcgtctggtacttctaatatgaagtttgttatgaacggtggtttgattatt
ggtactgttgatggtgccaatgtggaaatcacaagggaaattggtgaagataatgtcttc
ttgtttggtaacctaagtgaaaatgtcgaagaattgagatacaaccatcaataccatcca
caagatttaccatctagtttggattctgttttatcctacattgaaagtggacaattttct
ccagaaaatccaaatgaattcaaacctttagtcgacagtattaagtaccacggcgattat
tacctggtcagtgatgactttgaatcctatctggccacccatgaattagtggaccaggag
ttccacaatcaaaggtcagaatggttaaaaaagagtgtcctgagcgttgcaaacgtcggc
ttctttagcagtgatcgttgtatcgaggaatactccgataccatttggaacgttgaacca
gtgacttag

DBGET integrated database retrieval system