KEGG   Saccharomyces cerevisiae (budding yeast): YPR161CHelp
Entry
YPR161C           CDS       T00005                                 

Gene name
SGV1, BUR1
Definition
(RefSeq) cyclin-dependent serine/threonine protein kinase SGV1
  KO
K15562  serine/threonine-protein kinase BUR1 [EC:2.7.11.22 2.7.11.23]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YPR161C (SGV1)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YPR161C (SGV1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     YPR161C (SGV1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     YPR161C (SGV1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: CMGC group
  CDK family
   YPR161C (SGV1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    BUR kinase complex
     YPR161C (SGV1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 856290
NCBI-ProteinID: NP_015487
SGD: S000006365
UniProt: P23293
Position
XVI:complement(864449..866422)
Genome map
AA seq 657 aa AA seqDB search
MSDNGSPAVLPKTEFNKYKIGKVKSTPAIQRDAKTNLTYIKLRKRSSEKVYGCTVFQNHY
REDEKLGQGTFGEVYKGIHLETQRQVAMKKIIVSVEKDLFPITAQREITILKRLNHKNII
KLIEMVYDHSPDITNAASSNLHKSFYMILPYMVADLSGVLHNPRINLEMCDIKNMMLQIL
EGLNYIHCAKFMHRDIKTANILIDHNGVLKLADFGLARLYYGCPPNLKYPGGAGSGAKYT
SVVVTRWYRAPELVLGDKQYTTAVDIWGVGCVFAEFFEKKPILQGKTDIDQGHVIFKLLG
TPTEEDWAVARYLPGAELTTTNYKPTLRERFGKYLSETGLDFLGQLLALDPYKRLTAMSA
KHHPWFKEDPLPSEKITLPTEESHEADIKRYKEEMHQSLSQRVPTAPRGHIVEKGESPVV
KNLGAIPRGPKKDDASFLPPSKNVLAKPPPSKIRELHQNPRPYHVNSGYAKTAIPPPAAP
AGVNRYGPNNSSRNNRFSGNSTAPNNSRNPVNRFHPETNVSSKYNKVPLPLGPQSRYQGN
SNESRYKNSPNDSRYHNPRYVNKPETNFNRQPQKYSRQESNAPINKNYNPSNGSRNMAGD
HHQGSRPSHPQFPISPSQGQHQLTSKPIEKKNGSFKDERAKPDESKEFQNSDIADLY
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataatggttcccccgcggttcttccaaaaaccgaatttaataaatacaaaatc
ggcaaagtgaagagtacaccagccatccagcgagatgcgaagactaacttaacatacatc
aaactaagaaaaagaagtagtgagaaagtttacgggtgtacagttttccagaatcattat
cgtgaggatgaaaaattaggacaaggaacatttggtgaggtttataagggaattcattta
gagactcaaagacaagtggcaatgaaaaaaattatagttagcgttgaaaaagatctgttt
cctataactgcacaacgagaaattactattttaaagcgtttaaaccacaaaaatattatt
aaactaatcgaaatggtgtatgaccattcaccggatattacaaatgcggcatccagcaac
ctacataagtcattctacatgatcctgccgtatatggtagcagatctgtcgggcgttttg
cataatccgagaatcaacttagagatgtgcgatataaagaatatgatgctacaaatatta
gaaggcctaaattatattcattgtgcaaaattcatgcatagggatataaagacagcaaat
attttgattgaccacaacggtgttttaaagcttgctgattttggtttagcaagattatat
tatggctgtcctccaaacttaaagtatcctggtggtgcaggttccggcgccaaatataca
tcagtagtcgtaacgagatggtatagagcacctgagttggtgcttggtgataaacagtat
acaacagctgttgatatatggggtgtcggatgcgttttcgcagaattttttgagaaaaaa
cctattttacagggaaaaacggatattgatcagggacatgttattttcaaactacttggt
acaccgacagaagaagattgggccgtggctagatatttgccaggtgctgaactaacaaca
actaattacaagccaacgttgagggaaagatttggtaaatatctaagtgaaacaggtcta
gattttttaggacagttgttagcgttagatccttacaagaggttgaccgctatgtctgct
aaacaccatccttggtttaaagaggaccctttaccatcagagaagataacattaccgacg
gaagaaagtcatgaagctgatattaagaggtacaaggaagaaatgcaccaatcattgtcc
caaagagtacctactgcgccaagaggtcatatagttgaaaagggtgaatcacctgtcgtg
aaaaatcttggggcgatcccaagaggccccaagaaagatgacgcaagttttttgcctcca
tcaaagaacgtattggctaagccgcctccttcgaaaataagagaactacatcaaaatcct
agaccgtatcatgtgaacagcggatatgctaaaactgcgattccaccgccagcagcccct
gcaggagttaatagatacggacccaacaatagttccagaaataatcgcttcagcggcaac
agcactgcacccaacaacagcaggaatcccgtaaatcgatttcatcctgagacaaatgtc
agctctaaatataataaagtacctttgccattggggcctcagtcaagataccagggtaat
tcaaatgagtcccggtacaaaaactcgccaaatgactctagatatcataaccctaggtac
gtgaacaagccggaaaccaacttcaataggcaaccacagaaatatagtcgccaagaatcc
aatgcgccaatcaataaaaattataatccttcaaacggttctcgcaatatggctggtgat
catcatcaaggctcgagaccttctcatccacaattcccaatctcgccctcacaggggcag
catcagcttacgagtaaaccaatagagaaaaaaaatggaagctttaaggatgaaagagcg
aaaccagatgagtctaaggagttccaaaatagtgatattgcagatctatattag

DBGET integrated database retrieval system