KEGG   Saccharomyces cerevisiae (budding yeast): YPR167CHelp
Entry
YPR167C           CDS       T00005                                 

Gene name
MET16
Definition
(RefSeq) phosphoadenylyl-sulfate reductase (thioredoxin)
  KO
K00390  phosphoadenosine phosphosulfate reductase [EC:1.8.4.8 1.8.4.10]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00920  Sulfur metabolism
sce01100  Metabolic pathways
Module
sce_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    YPR167C (MET16)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.8  phosphoadenylyl-sulfate reductase (thioredoxin)
     YPR167C (MET16)
    1.8.4.10  adenylyl-sulfate reductase (thioredoxin)
     YPR167C (MET16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct
Motif
Other DBs
NCBI-GeneID: 856296
NCBI-ProteinID: NP_015493
SGD: S000006371
UniProt: P18408
Structure
PDB: 

Position
XVI:complement(876847..877632)
Genome map
AA seq 261 aa AA seqDB search
MKTYHLNNDIIVTQEQLDHWNEQLIKLETPQEIIAWSIVTFPHLFQTTAFGLTGLVTIDM
LSKLSEKYYMPELLFIDTLHHFPQTLTLKNEIEKKYYQPKNQTIHVYKPDGCESEADFAS
KYGDFLWEKDDDKYDYLAKVEPAHRAYKELHISAVFTGRRKSQGSARSQLSIIEIDELNG
ILKINPLINWTFEQVKQYIDANNVPYNELLDLGYRSIGDYHSTQPVKEGEDERAGRWKGK
AKTECGIHEASRFAQFLKQDA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctatcatttgaataatgatataattgtcacacaagaacagttggatcattgg
aatgaacaactaatcaagctggaaacgccacaggagattattgcatggtctatcgtaacg
tttcctcaccttttccaaaccactgcatttggtttgactggcttggttactatcgatatg
ttgtcaaagctatctgaaaaatactacatgccagaactattatttatagacactttgcac
catttcccacaaactttaacactaaaaaacgagattgagaaaaaatactaccagcctaaa
aatcaaaccattcacgtatataagccggatggatgtgaatcggaggcagattttgcctcg
aaatacggggatttcttatgggagaaagatgatgacaagtacgattatctggccaaagtg
gaacctgcacatcgtgcctacaaagagctacatataagtgctgtgtttactggtagaaga
aaatcacaaggttctgcccgctcccaactgtcgattattgaaatagacgaacttaatgga
atcttaaaaataaatccattgatcaattggacgttcgagcaggttaaacagtatatagat
gcaaacaatgtaccatacaacgaacttttggaccttggatatagatccattggtgattac
cattccacacaacccgtcaaggaaggtgaagatgagagagcaggaagatggaagggcaag
gccaagaccgagtgtggaattcatgaagccagccgattcgcgcaatttttaaagcaagat
gcctag

DBGET integrated database retrieval system