KEGG   Saccharomyces cerevisiae (budding yeast): YPR172WHelp
Entry
YPR172W           CDS       T00005                                 

Definition
(RefSeq) pyridoxal 5'-phosphate synthase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Putative_PNPOx Pyrid_ox_like L_biotic_typeA
Motif
Other DBs
NCBI-GeneID: 856302
NCBI-ProteinID: NP_015498
SGD: S000006376
UniProt: Q06608
Position
XVI:885796..886398
Genome map
AA seq 200 aa AA seqDB search
MAWTSTLPAHLLNLIKNSKYVHVATCSKDCIPSVALMNYIYVPGEKLFGQTDNKNDYIIF
VSPQDTQKFYNIKENPKVALLFHDWIIANNLSVGKESISGTPTPTSIPHEEQRQSELLNL
LQELNQAELNQMSASIGGETEIVNPESEESKYYKDLILKANPDAKAFIFEKNTAVVKVRI
DNARVSNNENRTMFLSKGKS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcttggactagtacattaccagcgcatctactgaacctgatcaaaaactccaaatat
gttcacgtggccacctgttctaaagactgcatcccttcagtggcattgatgaactatatc
tatgtgccaggtgaaaaactgttcggtcaaacagataataagaatgactacattatattt
gtttctcctcaggacacacaaaagttttacaacatcaaggagaaccctaaggtcgccctg
ttgtttcacgattggatcatcgcgaataatttgtcagtgggcaaggaaagcatctctggg
actccgacgccgacttctattcctcatgaagagcaacgtcaaagcgagcttttaaatttg
ttacaggagttaaatcaagccgaattgaaccaaatgagcgcatctattggtggcgaaacc
gaaattgtcaatcctgaaagtgaagaatccaagtactataaagatttaatactaaaggct
aatcctgatgcgaaagcttttatatttgaaaagaacaccgccgttgttaaagttagaatt
gataatgctagggtatccaataatgagaacagaacaatgtttctaagtaaagggaagagt
taa

DBGET integrated database retrieval system