KEGG   Saccharomyces cerevisiae (budding yeast): YPR173CHelp
Entry
YPR173C           CDS       T00005                                 

Gene name
VPS4, CSC1, DID6, END13, GRD13, VPL4, VPT10
Definition
(RefSeq) AAA family ATPase VPS4
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Module
sce_M00412  ESCRT-III complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YPR173C (VPS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YPR173C (VPS4)
Membrane trafficking [BR:sce04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    YPR173C (VPS4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA Vps4_C MIT AAA_lid_3 AAA_16 RuvB_N AAA_5 IstB_IS21 AAA_22 TIP49 AAA_14 DUF815 RNA_helicase AAA_2 AAA_18 AAA_33 AAA_24 AAA_25 AAA_17 AAA_7 Torsin Mg_chelatase Use1 PhoH Sigma54_activat Parvo_NS1 NACHT
Motif
Other DBs
NCBI-GeneID: 856303
NCBI-ProteinID: NP_015499
SGD: S000006377
UniProt: P52917
Structure
PDB: 

Position
XVI:complement(886524..887837)
Genome map
AA seq 437 aa AA seqDB search
MSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKF
TEYLNRAEQLKKHLESEEANAAKKSPSAGSGSNGGNKKISQEEGEDNGGEDNKKLRGALS
SAILSEKPNVKWEDVAGLEGAKEALKEAVILPVKFPHLFKGNRKPTSGILLYGPPGTGKS
YLAKAVATEANSTFFSVSSSDLVSKWMGESEKLVKQLFAMARENKPSIIFIDEVDALTGT
RGEGESEASRRIKTELLVQMNGVGNDSQGVLVLGATNIPWQLDSAIRRRFERRIYIPLPD
LAARTTMFEINVGDTPCVLTKEDYRTLGAMTEGYSGSDIAVVVKDALMQPIRKIQSATHF
KDVSTEDDETRKLTPCSPGDDGAIEMSWTDIEADELKEPDLTIKDFLKAIKSTRPTVNED
DLLKQEQFTRDFGQEGN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgggagattttttaactaagggaatagaactggttcaaaaggccattgacctg
gacacagccacgcagtatgaggaggcgtatacagcatactataacggattagattatttg
atgttggctttgaaatacgagaaaaaccctaagtcgaaggatttgataagagcgaagttt
acagagtatctaaaccgtgcagagcagttgaaaaagcacttggaaagtgaagaggcaaac
gcggcaaagaaatctcctagcgctggtagtggttccaacggtggtaataagaaaatctct
caggaagagggtgaggataatggtggagaagacaacaaaaagctaagaggtgccttatcg
agtgctattttgtctgagaagcccaatgttaagtgggaagacgtggctggactggaagga
gccaaagaggcccttaaagaagccgttattttacctgtcaagttcccacatttgttcaaa
ggtaaccgtaagcccacttcgggaatcttattgtacggaccaccaggtacaggtaaatca
tatttggcaaaagcagtggccaccgaggccaattctacctttttcagtgttagttccagt
gatttggtttctaagtggatgggtgaatctgaaaaacttgtcaaacagttatttgcgatg
gcaagagaaaataaaccttctattatttttatagatgaagtggatgcgctaacaggtacc
agaggagaaggagagagcgaagcaagtagaagaattaaaacagaattattggtacaaatg
aatggtgttgggaatgactcccaaggtgttttggtccttggcgcaacaaatatcccatgg
caactggacagtgccatcaggagaagatttgaaagaagaatatatataccattaccagat
ttggcggcaagaaccaccatgttcgagattaacgtcggcgacactccatgcgtattgacc
aaggaagattatagaactttaggtgcaatgactgaaggttattccgggagtgatattgct
gtagtggtgaaagatgcgctaatgcaaccgataagaaaaattcaaagcgcgacacatttc
aaagatgtctctacggaggacgacgaaacaagaaaactaacaccatgctctccaggtgat
gatggcgccatcgagatgagttggacggatattgaagctgatgaattaaaagaaccagat
ctcaccataaaggatttcttaaaggctatcaaatcgacgagacctaccgtgaatgaggat
gacttgctgaagcaagaacagttcactagagattttggtcaagaaggtaactag

DBGET integrated database retrieval system