KEGG   Saccharomyces cerevisiae (budding yeast): YPR175WHelp
Entry
YPR175W           CDS       T00005                                 

Gene name
DPB2
Definition
(RefSeq) DNA polymerase epsilon noncatalytic subunit
  KO
K02325  DNA polymerase epsilon subunit 2 [EC:2.7.7.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03410  Base excision repair
sce03420  Nucleotide excision repair
Module
sce_M00263  DNA polymerase epsilon complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YPR175W (DPB2)
   03410 Base excision repair
    YPR175W (DPB2)
   03420 Nucleotide excision repair
    YPR175W (DPB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YPR175W (DPB2)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YPR175W (DPB2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YPR175W (DPB2)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    YPR175W (DPB2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      YPR175W (DPB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_E_B DUF3206
Motif
Other DBs
NCBI-GeneID: 856305
NCBI-ProteinID: NP_015501
SGD: S000006379
UniProt: P24482
Structure
PDB: 

Position
XVI:888974..891043
Genome map
AA seq 689 aa AA seqDB search
MFGSGNVLPVKIQPPLLRPLAYRVLSRKYGLSIKSDGLSALAEFVGTNIGANWRQGPATI
KFLEQFAAVWKQQERGLFIDQSGVKEVIQEMKEREKVEWSHEHPIQHEENILGRTDDDEN
NSDDEMPIAADSSLQNVSLSSPMRQPTERDEYKQPFKPESSKALDWRDYFKVINASQQQR
FSYNPHKMQFIFVPNKKQNGLGGIAGFLPDIEDKVQMFLTRYYLTNDRVMRNENFQNSDM
FNPLSSMVSLQNELSNTNRQQQSSSMSITPIKNLLGRDAQNFLLLGLLNKNFKGNWSLED
PSGSVEIDISQTIPTQGHYYVPGCMVLVEGIYYSVGNKFHVTSMTLPPGERREITLETIG
NLDLLGIHGISNNNFIARLDKDLKIRLHLLEKELTDHKFVILGANLFLDDLKIMTALSKI
LQKLNDDPPTLLIWQGSFTSVPVFASMSSRNISSSTQFKNNFDALATLLSRFDNLTENTT
MIFIPGPNDLWGSMVSLGASGTLPQDPIPSAFTKKINKVCKNVVWSSNPTRIAYLSQEIV
IFRDDLSGRFKRHRLEFPFNESEDVYTENDNMMSKDTDIVPIDELVKEPDQLPQKVQETR
KLVKTILDQGHLSPFLDSLRPISWDLDHTLTLCPIPSTMVLCDTTSAQFDLTYNGCKVIN
PGSFIHNRRARYMEYVPSSKKTIQEEIYI
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgtttggctctgggaatgttctgcctgttaaaattcagcctccgctgcttaggccactg
gcgtatagagttttatcaagaaaatatggtttatcaattaaatctgatggactgtctgct
cttgcagaattcgttggcactaatataggtgctaactggagacaagggcctgctacaata
aaatttctcgagcaatttgctgcagtatggaaacaacaagaaagaggccttttcatcgac
cagagcggggttaaagaagttatacaggagatgaaagaacgtgagaaagtcgaatggagt
catgaacaccctattcaacatgaggagaatatcttgggacggacagatgacgatgagaac
aacagtgacgatgaaatgccgatcgctgctgattcatccttacaaaatgtttcattatct
tcacccatgcgacagcccaccgaaagagatgaatataaacagcctttcaagccagaaagc
tccaaggcgttggactggagggactacttcaaagttatcaatgcttctcagcaacaaaga
ttctcatacaatccgcacaaaatgcaatttattttcgtccccaataaaaagcagaatggg
ctaggaggcattgcgggttttctaccagatatagaggacaaagttcaaatgttcttgaca
agatattacctcacgaacgacagagtcatgagaaatgaaaacttccaaaacagtgacatg
tttaatccattatcatctatggtgtctttacaaaatgaactgtccaatactaaccgacag
cagcaatccagcagtatgagtatcaccccaataaaaaacctactaggtagggatgctcaa
aactttctactattggggctcttaaataagaactttaagggcaattggtcactggaagat
ccgtctggatctgtcgaaattgacatttcccaaactatccctacacaaggccattactac
gtgccaggttgcatggttcttgtggaaggaatatactattctgtaggaaataaattccat
gttacctccatgactttaccccctggtgagagaagagaaattacattagaaacgataggt
aatctcgatctcttaggaatacatggcatttctaataacaatttcattgctcgtttggat
aaagatttgaagattagattacaccttttggagaaagaattaacagatcataaatttgta
attctcggcgcaaatttgttcctagatgatttgaaaattatgactgcactcagcaaaatt
ttgcaaaaattaaatgatgacccaccgaccctattaatttggcaaggttctttcacttca
gttcccgttttcgcatcaatgagtagccggaatataagtagttccactcaatttaagaat
aatttcgatgccttggcgacgcttctgtcaagatttgacaatttgaccgaaaataccaca
atgatatttattccaggtcctaacgatttatgggggtcgatggtgtcattgggggcaagt
gggacattaccgcaagatccaattcctagtgcgtttaccaaaaaaatcaacaaggtctgt
aaaaacgttgtatggagctcaaatccaactagaatagcatacttatcccaagaaatagtc
attttcagggacgatttatccggaagattcaaaagacaccgtttggaattcccattcaac
gagagcgaagatgtttatactgaaaacgataacatgatgtctaaagacaccgatattgta
ccaatcgatgaattagttaaagaaccagaccagttaccacaaaaggttcaagaaacaaga
aaactcgttaaaacaatactagaccagggtcatttatcgccatttcttgattccttgcgc
ccaatttcatgggatttggaccacactttgacactttgcccaataccatcgacaatggtt
ctttgcgacactacttctgcacaatttgatttgacatacaacggttgtaaagtaattaac
cctggaagtttcattcataatagacgtgctaggtatatggagtacgttccatcctcaaag
aaaactatacaagaagagatatatatctaa

DBGET integrated database retrieval system