KEGG   Saccharomyces cerevisiae (budding yeast): YPR179CHelp
Entry
YPR179C           CDS       T00005                                 

Gene name
HDA3, PLO1
Definition
(RefSeq) Hda3p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HDA2-3
Motif
Other DBs
NCBI-GeneID: 856309
NCBI-ProteinID: NP_015505
SGD: S000006383
UniProt: Q06623
Structure
PDB: 

Position
XVI:complement(893797..895764)
Genome map
AA seq 655 aa AA seqDB search
MDLLRILDTKPIPTIVDATTLGISGNTSGDYWLPTTMSLYQKELTDQIVSLHYSDILRYF
ETSHYKEDVILESMKTMCLNGSLVATHPYLLIDHYMPKSLITRDVPAHLAENSGKFSVLR
DLINLVQEYETETAIVCRPGRTMDLLEALLLGNKVHIKRYDGHSIKSKQKANDFSCTVHL
FSSEGINFTKYPIKSKARFDMLICLDTTVDTSQKDIQYLLQYKRERKGLERYAPIVRLVA
INSIDHCRLFFGKKFDKNSREYLENVTAAMVILRDRLGTLPPDLRPIYSQKLHYLVEWLE
NPTVPWPLPDIYPLKQYTSMDVERSLLTEVHFKKSDDQLEDAFSNCSKKRGRHGANKAAS
STVAGIEDNITPSFYSTKRLKNDYYTNPLKQDMTQLTGITTADNSSNVNYHLSSGIITHK
LIQSMGEVYMDICVQKQELDDYSCLDDLQNDHLKFFSNEDEKIIKEYETVLRTNNENLNR
SHELEVENNLKFSQIETLEKDIETLKGSLMAQGETLSKLKDAFVKTDNVQDEIEKEERVS
VSRDTEKKYMEQEIKRAVDAIRENEEETHKLNEKQNGLESELKLKFEKSEISTKELNEKI
GFLKKELKLENDLNEELVGQLSKTMDNLENLTIPRVRTQNGNTKKKSRAKKPGNV
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggatttactacgcattttagacacgaaaccaatacctacaattgttgatgctactact
ctgggaatctcaggaaatacttccggtgattattggctgccaactacaatgtcgctttat
caaaaagaactcacggatcaaatagtatcattacactactcagatatcttgagatacttc
gaaacgtcacactacaaagaggacgtcattctcgaatctatgaagaccatgtgtttaaat
ggttcactggtagcaacccatccatacctactaatagatcattatatgcctaaatcgtta
ataactcgtgatgttcctgcacatttagcggaaaatagtggaaagttcagcgttttgaga
gatctcataaatcttgttcaagaatatgaaactgaaacggccattgtttgtagacctggg
agaacaatggacttactggaagccttactattgggaaataaggtgcatatcaaaagatat
gacggtcattctatcaagtcaaaacaaaaggcaaatgacttctcgtgtacagttcatttg
ttttcttctgaaggaattaatttcacaaaatatccgataaaatccaaggctcgattcgac
atgctgatctgcttagatactacagtggatacaagtcaaaaagatattcaatatttgttg
caatataagagggagaggaagggtttagaaagatatgctccaattgttaggctagtggcc
attaattcaattgatcattgtaggttattctttggtaaaaaatttgacaagaacagtaga
gaatacttggagaacgttaccgcagctatggtaattttaagagatcgactgggcacactt
ccacctgatttgaggcccatttattcacaaaagctgcattatttagtagaatggttggaa
aacccaacagtaccgtggccattaccagatatttaccctttaaaacaatatacttccatg
gatgtagaaaggtctttgttaacggaagtacatttcaaaaagtcagatgatcaactagag
gatgctttttccaactgttccaaaaaaagaggacgccatggtgctaataaggcagcatct
tcaactgttgccggaattgaggataatattactccaagtttttactctaccaaaagatta
aagaacgattattatacaaatcctttaaaacaagacatgacacaactaacaggtattact
acagctgacaactcctcgaatgtaaattaccacttatcaagtggaatcataacacacaaa
ctgattcaatcaatgggagaagtgtatatggatatttgcgttcagaaacaggagctggat
gattattcttgccttgatgatttgcaaaatgatcatctgaaatttttctcaaatgaagat
gagaaaattataaaagaatatgaaaccgtattgcgaaccaataatgaaaacttaaatagg
tcgcatgaactagaagttgaaaacaatttgaagttttcccaaatcgaaacactggaaaaa
gacattgaaactttaaagggaagtttgatggcccaaggtgaaacattatcaaagttaaaa
gacgctttcgttaaaacagacaatgtacaagacgagatcgagaaagaagaaagggtaagt
gtatcaagggatactgagaagaaatatatggaacaagaaatcaaaagagccgttgatgct
ataagggaaaatgaggaggagacacacaaacttaatgagaaacaaaatggattagaaagt
gagttgaaattgaaattcgaaaagtctgaaatctctacaaaagaattgaatgagaaaatt
ggctttttgaaaaaggaattaaagcttgagaatgatctaaacgaggagttagtgggacag
ttatcgaagacgatggacaacttggaaaacttaacaattccacgagttcgtactcaaaat
ggtaacacaaaaaaaaaatccagggcaaaaaaaccaggaaatgtataa

DBGET integrated database retrieval system