KEGG   Saccharomyces cerevisiae (budding yeast): YPR180WHelp
Entry
YPR180W           CDS       T00005                                 

Gene name
AOS1, RHC31
Definition
(RefSeq) E1 ubiquitin-activating protein AOS1
  KO
K10684  ubiquitin-like 1-activating enzyme E1 A [EC:6.2.1.45]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YPR180W (AOS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YPR180W (AOS1)
Enzymes [BR:sce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     YPR180W (AOS1)
Ubiquitin system [BR:sce04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   YPR180W (AOS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiF
Motif
Other DBs
NCBI-GeneID: 856310
NCBI-ProteinID: NP_015506
SGD: S000006384
UniProt: Q06624
Position
XVI:895961..897004
Genome map
AA seq 347 aa AA seqDB search
MDMKVEKLSEDEIALYDRQIRLWGMTAQANMRSAKVLLINLGAIGSEITKSIVLSGIGHL
TILDGHMVTEEDLGSQFFIGSEDVGQWKIDATKERIQDLNPRIELNFDKQDLQEKDEEFF
QQFDLVVATEMQIDEAIKINTLTRKLNIPLYVAGSNGLFAYVFIDLIEFISEDEKLQSVR
PTTVGPISSNRSIIEVTTRKDEEDEKKTYERIKTKNCYRPLNEVLSTATLKEKMTQRQLK
RVTSILPLTLSLLQYGLNQKGKAISFEQMKRDAAVWCENLGVPATVVKDDYIQQFIKQKG
IEFAPVAAIIGGAVAQDVINILGKRLSPLNNFIVFDGITLDMPLFEF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggatatgaaagtagaaaaattaagtgaagatgaaattgcactgtatgatagacagatt
cgtctatggggaatgacagcacaggccaatatgagatcagcaaaagtattgctgatcaat
cttggagcaattggttctgaaattaccaaaagtatcgtccttagtggtatagggcattta
accatattggatggacacatggtgactgaagaagatttaggatcccagttcttcataggc
tctgaagatgttggccaatggaagattgatgcaacaaaagagagaattcaagacttgaac
ccccgtatagagttgaactttgataagcaggatttgcaagaaaaggacgaagagttcttt
cagcagtttgatttagtcgtggctacagaaatgcagattgatgaagcaatcaaaattaac
acattaactcgaaaactaaacattccattatatgttgctggttctaatggattgttcgct
tatgtttttattgatttgattgaattcatttcagaggatgaaaaattgcaaagtgtaaga
cctaccaccgttggtcccatttcaagcaataggagcattatagaagttactactagaaaa
gatgaagaagatgaaaaaaaaacatatgaacgaatcaagaccaagaactgctataggcca
ctgaacgaagttttaagcacagcaacattaaaggaaaaaatgacgcaaagacagttaaaa
agagtcactagtatcttgccgttaaccctgtccttattgcaatatggtctcaaccaaaag
ggcaaggccataagctttgaacaaatgaaaagagatgcggccgtatggtgtgaaaatctg
ggtgtaccagcaacagtggtaaaggacgattacatacaacagtttatcaaacagaaaggt
atcgagtttgctcctgtcgcggccattatagggggtgctgtagcgcaggatgtcattaac
attctaggtaaaaggctatctccattaaataatttcattgtttttgatggtattacatta
gacatgccactttttgagttttag

DBGET integrated database retrieval system