KEGG   Saccharomyces cerevisiae (budding yeast): YPR181CHelp
Entry
YPR181C           CDS       T00005                                 

Gene name
SEC23
Definition
(RefSeq) GTPase-activating protein SEC23
  KO
K14006  protein transport protein SEC23
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Module
sce_M00404  COPII complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YPR181C (SEC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YPR181C (SEC23)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    YPR181C (SEC23)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sec23_trunk Sec23_BS Sec23_helical zf-Sec23_Sec24 Gelsolin Vps36-NZF-N zf-MIZ
Motif
Other DBs
NCBI-GeneID: 856311
NCBI-ProteinID: NP_015507
SGD: S000006385
UniProt: P15303
Structure
PDB: 

Position
XVI:complement(897361..899667)
Genome map
AA seq 768 aa AA seqDB search
MDFETNEDINGVRFTWNVFPSTRSDANSNVVPVGCLYTPLKEYDELNVAPYNPVVCSGPH
CKSILNPYCVIDPRNSSWSCPICNSRNHLPPQYTNLSQENMPLELQSTTIEYITNKPVTV
PPIFFFVVDLTSETENLDSLKESIITSLSLLPPNALIGLITYGNVVQLHDLSSETIDRCN
VFRGDREYQLEALTEMLTGQKPTGPGGAASHLPNAMNKVTPFSLNRFFLPLEQVEFKLNQ
LLENLSPDQWSVPAGHRPLRATGSALNIASLLLQGCYKNIPARIILFASGPGTVAPGLIV
NSELKDPLRSHHDIDSDHAQHYKKACKFYNQIAQRVAANGHTVDIFAGCYDQIGMSEMKQ
LTDSTGGVLLLTDAFSTAIFKQSYLRLFAKDEEGYLKMAFNGNMAVKTSKDLKVQGLIGH
ASAVKKTDANNISESEIGIGATSTWKMASLSPYHSYAIFFEIANTAANSNPMMSAPGSAD
RPHLAYTQFITTYQHSSGTNRIRVTTVANQLLPFGTPAIAASFDQEAAAVLMARIAVHKA
ETDDGADVIRWLDRTLIKLCQKYADYNKDDPQSFRLAPNFSLYPQFTYYLRRSQFLSVFN
NSPDETAFYRHIFTREDTTNSLIMIQPTLTSFSMEDDPQPVLLDSISVKPNTILLLDTFF
FILIYHGEQIAQWRKAGYQDDPQYADFKALLEEPKLEAAELLVDRFPLPRFIDTEAGGSQ
ARFLLSKLNPSDNYQDMARGGSTIVLTDDVSLQNFMTHLQQVAVSGQA
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggacttcgagactaatgaagacatcaacggggtccgtttcacctggaacgtgtttccc
tctactagaagcgacgctaacagcaacgtcgtccctgtgggctgtttgtacacacctttg
aaggagtatgacgaattgaacgttgccccatacaatccagttgtgtgttccggtccacac
tgtaagtcgattctaaatccttactgtgtgattgatccgcgcaattcgtcctggagttgt
cccatctgtaactccaggaaccatttacctccacagtacaccaacttgtcacaggagaat
atgccgctagagttacagtccaccaccattgagtacatcaccaataagcccgttaccgtt
cctcccattttcttctttgttgtggatttgacttcggaaaccgagaacctcgattcgcta
aaggagtctatcatcacttctttgtctctattacctcccaacgcgctgattgggttgatc
acttacggaaacgttgttcaattgcacgatctgtccagcgaaactattgacaggtgcaac
gtgttcagaggagacagggagtaccagctcgaagcgttgacggaaatgttgaccggccaa
aagcctaccggccccggcggtgctgcatctcatctaccgaacgccatgaacaaagttacg
cccttctctttgaataggttcttcctgcccttggaacaggtcgagttcaaactgaatcaa
ttactggaaaatctgtctccagaccaatggtctgttccagcgggtcataggccattaagg
gccacaggttccgctttgaacattgcatctttgcttttacagggctgctataagaacatc
ccagcaagaatcattcttttcgcctccggtccaggcaccgtggccccaggtttgattgtt
aactcagagttaaaagatcccttaagatcccaccacgacatcgattctgatcacgcgcaa
cattacaagaaggcctgtaagttttacaaccagattgcacaaagagttgccgccaatgga
cacactgttgatatttttgccggttgttacgatcaaatcggtatgtctgaaatgaaacag
ttgaccgactctactggaggtgtgttgttgctaaccgatgccttctctaccgcgattttt
aagcaatcatacttgagattgtttgccaaggatgaagaagggtatttgaagatggctttc
aatggtaatatggcagtcaagacaagtaaagacttgaaggtacaaggtttgattgggcat
gcttctgctgtaaagaagacagacgctaacaacatcagtgaatctgaaatcggtataggt
gcaacgtccacctggaagatggcttccttatcgccttatcactcgtatgcgattttcttt
gaaattgcaaacactgcggctaattctaacccaatgatgtctgcccctggttcagcagat
agacctcatctagcatatactcaattcatcactacttatcaacactcctctggtaccaac
cgtatcagagtcaccacggtcgcaaaccagcttttgcccttcggtactcctgccattgca
gcttctttcgatcaagaagctgctgccgttttgatggctcgtattgctgttcacaaggct
gaaaccgatgatggtgcagatgttattagatggttagacagaactttgattaagctatgt
caaaagtacgccgactataataaagatgatcctcaatctttcaggttggctccaaatttc
tcactgtatcctcaatttacctattatttaagaagatcccaattcttaagtgtctttaac
aattctccggatgaaactgcattttatagacatattttcacaagagaggatacgactaat
tctttaatcatgattcaaccaactctaacttctttctcaatggaggacgatccacaaccg
gtattattagactctatctccgtcaaacccaataccattctattattagatacatttttc
ttcatcttaatataccacggtgagcaaatcgctcaatggagaaaagccggttaccaagac
gatccacagtacgcagatttcaaagctcttcttgaagagccaaaattagaagccgcagaa
ttgttagtagataggttcccgctaccaagattcattgatactgaagccggtggttctcaa
gccagattcttgttatctaaattgaatccttccgataactatcaagacatggcgcgcgga
ggatctacaattgtcttaacagatgatgtttccttacaaaatttcatgactcacttacaa
caagtagccgtctctggtcaggcatag

DBGET integrated database retrieval system