KEGG   Saccharomyces cerevisiae (budding yeast): YPR182WHelp
Entry
YPR182W           CDS       T00005                                 

Gene name
SMX3
Definition
(RefSeq) mRNA splicing protein SMX3
  KO
K11098  small nuclear ribonucleoprotein F
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03040  Spliceosome
Module
sce_M00351  Spliceosome, U1-snRNP
sce_M00398  Sm core complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YPR182W (SMX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YPR182W (SMX3)
   03032 DNA replication proteins [BR:sce03032]
    YPR182W (SMX3)
Spliceosome [BR:sce03041]
 Complex A
  U1 snRNP components
   Sm proteins
    YPR182W (SMX3)
  U2 snRNP components
    YPR182W (SMX3)
 Complex B
  U1 snRNP components
    YPR182W (SMX3)
  U4/U6.U5 tri-snRNP components
    YPR182W (SMX3)
 Complex C
  U2 snRNP components
    YPR182W (SMX3)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     YPR182W (SMX3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LSM
Motif
Other DBs
NCBI-GeneID: 856312
NCBI-ProteinID: NP_015508
SGD: S000006386
UniProt: P54999
Structure
PDB: 

Position
XVI:900194..900454
Genome map
AA seq 86 aa AA seqDB search
MSESSDISAMQPVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFV
AGVSHGTLGEIFIRCNNVLYIRELPN
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagagcagtgatatcagcgcgatgcagccggtgaacccgaagccgttcctcaaa
ggcctggtcaaccatcgtgtaggcgtcaagcttaagttcaacagcaccgaatatagaggt
acgctcgtgtccacggacaactactttaacctgcagctgaacgaagcagaagagtttgtt
gcgggtgtctcgcacggcaccctgggcgagatattcatccgctgcaataacgtgctgtac
atcagggagctgccgaactaa

DBGET integrated database retrieval system