KEGG   Saccharomyces cerevisiae (budding yeast): YPR185WHelp
Entry
YPR185W           CDS       T00005                                 

Gene name
ATG13, APG13
Definition
(RefSeq) serine/threonine protein kinase regulatory subunit ATG13
  KO
K08331  autophagy-related protein 13
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04136  Autophagy - other
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YPR185W (ATG13)
   04136 Autophagy - other
    YPR185W (ATG13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YPR185W (ATG13)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YPR185W (ATG13)
Membrane trafficking [BR:sce04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    YPR185W (ATG13)
   Atg1 complex
    YPR185W (ATG13)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    YPR185W (ATG13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATG13 PBP_sp32
Motif
Other DBs
NCBI-GeneID: 856315
NCBI-ProteinID: NP_015511
SGD: S000006389
UniProt: Q06628
Position
XVI:907218..909434
Genome map
AA seq 738 aa AA seqDB search
MVAEEDIEKQVLQLIDSFFLKTTLLICSTESSRYQSSTENIFLFDDTWFEDHSELVSELP
EIISKWSHYDGRKELPPLVVETYLDLRQLNSSHLVRLKDHEGHLWNVCKGTKKQEIVMER
WLIELDNSSPTFKSYSEDETDVNELSKQLVLLFRYLLTLIQLLPTTELYQLLIKSYNGPQ
NEGSSNPITSTGPLVSIRTCVLDGSKPILSKGRIGLSKPIINTYSNALNESNLPAHLDQK
KITPVWTKFGLLRVSVSYRRDWKFEINNTNDELFSARHASVSHNSQGPQNQPEQEGQSDQ
DIGKRQPQFQQQQQPQQQQQQQQQQQRQHQVQTQQQRQIPDRRSLSLSPCTRANSFEPQS
WQKKVYPISRPVQPFKVGSIGSQSASRNPSNSSFFNQPPVHRPSMSSNYGPQMNIEGTSV
GSTSKYSSSFGNIRRHSSVKTTENAEKVSKAVKSPLQPQESQEDLMDFVKLLEEKPDLTI
KKTSGNNPPNINISDSLIRYQNLKPSNDLLSEDLSVSLSMDPNHTYHRGRSDSHSPLPSI
SPSMHYGSLNSRMSQGANASHLIARGGGNSSTSALNSRRNSLDKSSNKQGMSGLPPIFGG
ESTSYHHDNKIQKYNQLGVEEDDDDENDRLLNQMGNSATKFKSSISPRSIDSISSSFIKS
RIPIRQPYHYSQPTTAPFQAQAKFHKPANKLIDNGNRSNSNNNNHNGNDAVGVMHNDEDD
QDDDLVFFMSDMNLSKEG
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggttgccgaagaggacatcgagaagcaagtccttcaattgatagacagcttttttctg
aagactacactactaatatgctccaccgaatcaagtcgataccagtcttctacagaaaat
atattcctatttgacgacacatggtttgaagatcactcagaattagtgagtgagctaccc
gagataatatcaaaatggtctcactacgatggtcgaaaagagttgccacccttagtggta
gagacatatttggatttaagacagttaaactcgtctcatttagttagattaaaggaccac
gaaggccatttgtggaacgtttgcaaaggaactaagaagcaggaaatcgtgatggaacgt
tggcttatcgaattagataattcatccccaactttcaaatcatacagtgaagatgagact
gatgttaatgaactttctaaacagctagtccttctcttccgttatttgttgactttaata
cagttactacccacaacagaattataccaattattaataaagtcttataacggcccgcaa
aatgaaggaagttccaatccaataacttccacgggcccactagtaagtatccggacgtgt
gtccttgacggatctaaaccaattttatcgaaggggagaatagggttgagcaaaccgatt
attaatacatattccaatgcgcttaacgaatcaaacctgccagcccatttagatcaaaag
aagatcacacctgtatggacaaagtttggactcttaagagtctcggtatcatacagacgt
gattggaagtttgaaattaacaatacaaacgacgaattattttcagctcgacatgcatct
gtctcacataactcacaaggaccccagaatcagccagaacaagaaggacaaagtgatcaa
gacatagggaaacgccaaccacaatttcaacagcagcagcagccccaacagcagcagcag
cagcagcaacagcaacagagacaacaccaggtccagacacaacaacaaagacagatacct
gataggagatctctttcactttctccttgtacaagagccaattcttttgaaccacaatct
tggcagaagaaagtctatccaatatcgagacctgttcaaccatttaaagttggttcaatt
ggaagtcaaagtgcgagcagaaatccctctaattcatcgtttttcaaccaaccacctgtt
cataggccaagtatgagctccaactacgggccacaaatgaatattgaaggtaccagtgtt
ggaagcacctcaaagtattcctcctcctttgggaacattcgtcgtcactcaagtgtaaag
acgacagagaatgctgaaaaagtatcaaaagctgtaaagagcccactacaacctcaagaa
tcacaagaagatttaatggattttgttaaattactcgaagaaaaacccgatctaactata
aagaagacaagtggaaataatccacccaatatcaatatttctgattctctaatcagatat
cagaatttgaagccaagtaatgacttattaagtgaagatttatccgtaagtttatccatg
gatccaaatcatacatatcacagaggcagatcagattcccactcaccattgccttcaata
tccccttcgatgcattatggatcgttgaactcgagaatgtctcaaggcgccaatgcaagc
catttgattgcaagaggcggtgggaattcatctactagtgccttgaatagtagaaggaat
tctttagataagagctcaaacaagcagggtatgtcaggcttacctcctatttttggtgga
gagagtacttcatatcaccacgacaacaaaatacaaaagtacaaccaattaggagtagaa
gaagatgatgatgacgagaatgaccgtttgctcaaccaaatgggaaacagtgctacaaaa
ttcaaaagttcaatatctccaagatcaattgatagcatttcaagttctttcataaaaagt
aggatacctatcagacaaccataccattactctcaaccaactactgcgccctttcaagct
caggcgaaatttcataaacctgcaaataagttaatcgataatggtaataggagtaatagt
aacaataacaatcataatgggaatgatgcagttggtgtgatgcataatgacgaggatgat
caagatgatgatctagtatttttcatgagtgatatgaacctttctaaagaaggttaa

DBGET integrated database retrieval system