KEGG   Saccharomyces cerevisiae (budding yeast): YPR188CHelp
Entry
YPR188C           CDS       T00005                                 

Gene name
MLC2
Definition
(RefSeq) Mlc2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 856318
NCBI-ProteinID: NP_015514
SGD: S000006392
UniProt: Q06580
Position
XVI:complement(911988..912479)
Genome map
AA seq 163 aa AA seqDB search
MDHSESLTFNQLTQDYINKLKDAFQMLDEDEDGLISRGDLTKIYATLGKTLTDEEWSKMV
PDNDTSTAEVGEEGVSFPIFLSIMGKNLSQFPEREELEESLKAIGRGHDLNVPLNEVIDS
LKEAGFENPEEEFAKLFKLFTTNQQATEERTFRGKLFLDSITD
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggaccatagtgaatcgctaacgtttaaccaacttacgcaggactacataaataaactc
aaagatgctttccaaatgctggatgaggatgaggatggtctgattagtaggggagatctt
accaagatatatgcaacattggggaagacattgacagatgaggaatggtccaaaatggta
cctgacaatgacaccagtaccgcggaagttggagaagaaggtgtaagctttcccatattc
ttatctatcatggggaagaacttatcgcagtttcccgagcgtgaagaattggaagaaagt
ttaaaagccattggaagaggacacgatttaaacgttcccttgaatgaggtcattgattct
ttaaaggaagccggttttgaaaatcctgaggaagaatttgctaaacttttcaaattgttt
actacaaatcagcaagcgaccgaagagagaactttcagaggtaagcttttcttagattca
atcaccgattaa

DBGET integrated database retrieval system