KEGG   Saccharomyces cerevisiae (budding yeast): YPR188C
Entry
YPR188C           CDS       T00005                                 

Symbol
MLC2
Name
(RefSeq) Mlc2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_8 SPARC_Ca_bdg Hist_deacetyl
Other DBs
NCBI-GeneID: 856318
NCBI-ProteinID: NP_015514
SGD: S000006392
UniProt: Q06580
Position
XVI:complement(911988..912479)
AA seq 163 aa
MDHSESLTFNQLTQDYINKLKDAFQMLDEDEDGLISRGDLTKIYATLGKTLTDEEWSKMV
PDNDTSTAEVGEEGVSFPIFLSIMGKNLSQFPEREELEESLKAIGRGHDLNVPLNEVIDS
LKEAGFENPEEEFAKLFKLFTTNQQATEERTFRGKLFLDSITD
NT seq 492 nt   +upstreamnt  +downstreamnt
atggaccatagtgaatcgctaacgtttaaccaacttacgcaggactacataaataaactc
aaagatgctttccaaatgctggatgaggatgaggatggtctgattagtaggggagatctt
accaagatatatgcaacattggggaagacattgacagatgaggaatggtccaaaatggta
cctgacaatgacaccagtaccgcggaagttggagaagaaggtgtaagctttcccatattc
ttatctatcatggggaagaacttatcgcagtttcccgagcgtgaagaattggaagaaagt
ttaaaagccattggaagaggacacgatttaaacgttcccttgaatgaggtcattgattct
ttaaaggaagccggttttgaaaatcctgaggaagaatttgctaaacttttcaaattgttt
actacaaatcagcaagcgaccgaagagagaactttcagaggtaagcttttcttagattca
atcaccgattaa

DBGET integrated database retrieval system