KEGG   Saccharomyces cerevisiae (budding yeast): YPR189WHelp
Entry
YPR189W           CDS       T00005                                 

Gene name
SKI3, SKI5
Definition
(RefSeq) SKI complex subunit tetratricopeptide repeat protein SKI3
  KO
K12600  superkiller protein 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03018  RNA degradation
Module
sce_M00392  Ski complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    YPR189W (SKI3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YPR189W (SKI3)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Ski complex
     YPR189W (SKI3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_22 TPR_2 TPR_8 TPR_19 TPR_11 TPR_1 TPR_14 TPR_17 TPR_16 ANAPC3 HrpB1_HrpK TPR_9 Alkyl_sulf_dimr
Motif
Other DBs
NCBI-GeneID: 856319
NCBI-ProteinID: NP_015515
SGD: S000006393
UniProt: P17883
Structure
PDB: 

Position
XVI:912664..916962
Genome map
AA seq 1432 aa AA seqDB search
MSDIKQLLKEAKQELTNRDYEETIEISEKVLKLDPDNYFAHIFLGKALSSLPASNNVSSN
RNLERATNHYVSAAKLVPDNLLAWKGLFLLFRTTEVVPDILSYDEYFDLCGQYADALLKQ
EQSQVELINDIKLLKKTHPDCQKAFYQHLKPGSLMAETIGRHLSTPQDALLNLIKILSNI
ETTEIGKTLSQNRLKLKASDPDYQIKLNSFSWEIIKNSEIDQLYNQLVNILADDQKRSEI
ENQWLEYRIKVLKSMPLDVKKDFFTKVKEMVEDMVLVNHQSLLAWQKYFEWTDYEDLDNM
DAPLIIKYFKKFPKDPLAMILYSWLSSKLSKYDIKSLESANKPPEGHKKTEKETDIKDVD
ETNEDEVKDRVEDEVKDRVEDEVKDQDEEAKEDEEEDLDDIEIGLLEEEVVTVLTENIVK
CKNNILAHRILCQYYLLTKEYEAALPYIKNGISLIAYNIKDLGVHLPLTKREFSLDLATV
YTYVDAPKDHNAALKLYDNILSGDFSNIQAKMGKGIIFIERKNWKDAMTLLTQVHEQSPN
NLEVLSELSWSKAHMGYMDEALAGLDTVIKGIKGMDLRSIDFRALNLWRQAKVYIMKHAS
INDAKQENVKCAFKLLIQSIKILDTFAPGFSTLGDIYCHYYKDHLRAFKCYFKAFDLDAG
DYTAAKYITETYASKPNWQAASSIASRLIKGEKAKAELRSNNWPFRVVGIAHLEKQEESD
SIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTFAQYFKAISL
CDVGEYLESLDILEKVCQEAATEESFQIGLVEVLMRCSLDLYSQGFLLKSVSIAKDTIER
IKIIISELKCENQQVWIYLSQVLRLFIWIESKVDTLPVESLVSIFENSQFSGSEEIDSVD
NIKIDTLLDSTTDDNVSIACKFLILASKYSVSDQKFTDIAGTVRASYWYNIGISELTAFI
TLKEPQYRDAAIFAFKKSIQLQSNTSETWIGLGIATMDINFRVSQHCFIKATALEPKATN
TWFNLAMLGLKKKDTEFAQQVLNKLQSLAPQDSSPWLGMALILEEQGDIIGSSKLFAHSF
ILSNGRSKAAQFMYAKNVLENHINNGDDERDIETVEKLTTASIALEQFFKKSPDSQFALQ
CALLTLERLHHYENANELANRLIGILEKKFEKTQDERELFNFAIIKGQFARIHLGLGNFE
LSIENADLSQGIISESSDEKSMKTKISNHICLGLSYFFLNDFDQTLNQFQELLSISKDSK
HLVVLIAKVLYDVGESDTKEIALQELTEYIATSGADLLVTLTIAAMSILDDKREDLSIIL
EELKALPLSKQIIDKHKDAPYLIEEITKRLYRNDTGKQVWQRSAYFFPNNLKVWERLDKN
IQRRIASNGQNKVTAEEMSKLYCESKNLRSIQRGMFLCPWNVTAVKALNECF
NT seq 4299 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatattaaacagctattgaaggaagccaaacaagaattgacaaatcgtgactat
gaagagaccatcgaaatatcggaaaaggttcttaaactagatcccgataattatttcgca
catatttttctagggaaagcactttcgagtcttccagctagtaataatgtcagttcaaat
cggaacctggagagagctactaatcattacgtgtccgctgccaaattagttcctgataac
cttttagcgtggaaaggactttttctcttatttagaaccactgaggttgtcccagacata
ctttcgtatgatgaatattttgacctgtgtggccaatatgcagacgcacttttaaagcag
gaacagtctcaagtagaactaataaatgacataaaattactaaagaaaacgcatccagat
tgtcaaaaagccttttatcagcatttgaaacctgggtcgctaatggcggaaactattggt
cgtcatctatctacaccccaggacgctttattaaatcttataaagatactgtctaatatt
gaaacaacggaaataggtaagacccttagtcagaacaggttaaaactaaaagctagtgat
cctgattatcaaattaaactaaattcattctcctgggaaataattaaaaattcagaaatt
gatcagttatacaaccagttggtaaatattctcgctgacgatcaaaagagaagtgaaatt
gagaaccagtggttagaatatagaatcaaagtgctaaaatcaatgccgctggatgtaaaa
aaagattttttcacgaaagttaaggaaatggtcgaggatatggttcttgtgaatcatcaa
tctttgcttgcatggcaaaagtatttcgaatggacagattacgaagatctggacaacatg
gatgccccattgataataaagtactttaagaaatttcctaaagatccattggccatgatc
ctctattcctggctttcctcaaaactatcgaaatatgatattaaaagtttggaatcggct
aataaaccacctgaaggccataaaaagacggagaaggaaacagatattaaggatgtagat
gagacaaatgaagatgaagttaaagatcgcgttgaagatgaagttaaagatcgtgttgaa
gatgaagtcaaagatcaagatgaggaggcaaaggaagatgaagaagaagaccttgatgat
atagaaattggtttattagaggaagaggttgtcactgtattgacggagaatatcgtaaaa
tgtaaaaataatatcttagcgcatcgcattctttgtcaatattacctactgaccaaggag
tatgaggcagctttaccatacatcaaaaatggtatttctttaattgcctataatataaag
gacctgggggtacatttgccattaacaaaaagagaattttctctggatttggctaccgtt
tatacatatgtcgatgccccaaaggaccacaatgctgcattaaagttatatgataacatt
ttatccggtgattttagtaatatacaagcaaaaatgggcaaaggtataatttttattgaa
aggaaaaattggaaggatgctatgacattactaacacaggtgcatgaacaatcgcctaat
aatctggaagttttatctgaactgtcatggagtaaagcccatatgggttatatggacgag
gcattagctggcttagatactgtcatcaagggtatcaaaggtatggatttacgttcgata
gatttcagagcattaaacttatggaggcaagccaaagtttacattatgaagcatgcttcc
attaacgatgctaaacaggaaaacgtcaagtgcgcattcaaattactcattcagagtatt
aaaatattggacacttttgctcccggattttcgacactgggcgatatttattgccactat
tataaagaccatttgagggccttcaaatgttatttcaaagctttcgatctggatgcgggg
gattacacagcagcgaagtatattaccgaaacttatgcaagcaagcccaattggcaagct
gcttcttccatcgcttcaagattaattaaaggtgaaaaagcaaaggcagaactgcgctca
aataactggccctttagggtcgtagggattgctcatttggaaaagcaagaagaaagtgat
tctattgagtggtttcaatctgctttacgtgttgatccaaatgatgtagagtcatgggtg
ggcctgggacaagcataccacgcgtgtggtcgtatagaagcatctatcaaagtttttgac
aaggcaattcaattaaggccctctcatacttttgcccaatactttaaagctatttctcta
tgtgacgtaggtgaatatcttgaaagtttagacattctggaaaaggtatgtcaagaagcc
gctacagaagagtcattccaaattggtttagtggaagtgcttatgagatgttccttggat
ttatattcgcaagggttcttgctcaaatcagtttcaattgcaaaggacactattgaacgg
atcaagataattatcagtgaattaaaatgtgagaaccaacaggtttggatctacctttca
caagtactgagattatttatttggatagagtcaaaggttgatactttacctgttgaatca
ctagtatcaatttttgaaaattctcaattttctggtagtgaagaaattgattctgtcgac
aatatcaaaatcgatactttactcgatagcactactgatgataatgtgtccattgcgtgc
aagtttttgatcttagcttcaaaatatagtgtttcggatcaaaaatttacagatatagca
ggaacggtcagggcctcatactggtataatataggtatctcagagcttactgctttcata
acattgaaagaaccgcagtatagagatgctgctatttttgcttttaagaaatccattcaa
ttacagtctaatacaagtgaaacttggattggtctagggatagccactatggacatcaac
tttcgtgtctctcaacattgctttattaaagcaactgctttggaaccgaaggcgacaaat
acatggttcaacttggctatgctaggtttaaagaaaaaggatactgaatttgctcaacag
gttctgaataaattacaaagccttgccccacaagattcgtcaccttggctaggtatggcc
ttgattcttgaggaacaaggagacattatcggaagttctaaactttttgcacactccttc
atattatctaatggaaggtcaaaggctgcgcaatttatgtatgctaaaaatgtccttgag
aatcacattaataatggtgacgatgaaagagatattgagacagtggaaaaactaaccact
gcttcaatagctttagagcagtttttcaaaaaaagtcctgatagtcaatttgctcttcaa
tgtgctcttctaactcttgaaaggttacatcactatgaaaatgcaaacgaactggctaat
cggttgataggcattttggaaaaaaagtttgagaaaactcaagatgaaagagaactgttt
aattttgcgataattaaaggacaattcgctcgtattcacttaggtttaggaaatttcgaa
ctctctattgaaaacgctgatctttctcaaggtattatatctgaatcgagcgacgaaaaa
tcaatgaaaaccaaaatatccaatcacatttgcttaggattaagttatttcttcttaaac
gactttgatcagactttgaaccaattccaagaactgctaagcatttcaaaggattctaag
cacctagttgttttaattgcgaaggtgctttatgatgtaggtgaatctgacacaaaggaa
attgctttacaggaactaacagaatatatagccacaagcggcgcagacttgttagtaaca
ctaacgattgcagctatgtcaattctagacgataagcgtgaagatttaagcattatttta
gaagaattgaaagctttgccattatccaaacaaataatagataagcacaaagacgcacca
tatctgatagaagaaattactaagagactttatcgtaacgataccggtaaacaagtatgg
caaaggagtgcgtactttttccctaataacctcaaggtttgggagagattagataagaat
attcaacgaagaatagcttctaatggacaaaataaagttactgcggaggagatgagtaaa
ctatattgtgagagtaagaatttgagaagcatacaaagaggtatgtttttgtgcccttgg
aacgttactgcagtgaaggcgctaaacgaatgtttctaa

DBGET integrated database retrieval system