KEGG   Saccharomyces cerevisiae (budding yeast): YPR198W
Entry
YPR198W           CDS       T00005                                 

Symbol
SGE1, NOR1
Name
(RefSeq) Sge1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: MFS_1 TRI12 MFS_4
Other DBs
NCBI-GeneID: 856327
NCBI-ProteinID: NP_015524
SGD: S000006402
UniProt: P33335
Position
XVI:934034..935665
AA seq 543 aa
MKSTLSLTLCVISLLLTLFLAALDIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFM
LLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVV
GTSIVRENHRGIMITALAISYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAFIILA
FCNTSGEPHQKMWLPSKIKKIMNYDYGELLKASFWKNTFEVLVFKLDMVGIILSSAGFTL
LMLGLSFGGNNFPWNSGIIICFFTVGPILLLLFCAYDFHFLSLSGLHYDNKRIKPLLTWN
IASNCGIFTSSITGFLSCFAYELQSAYLVQLYQLVFKKKPTLASIHLWELSIPAMIATMA
IAYLNSKYGIIKPAIVFGVLCGIVGSGLFTLINGELSQSIGYSILPGIAFGSIFQATLLS
SQVQITSDDPDFQNKFIEVTAFNSFAKSLGFAFGGNMGAMIFTASLKNQMRSSQLNIPQF
TSVETLLAYSTEHYDGPQSSLSKFINTAIHDVFYCALGCYALSFFFGIFTSSKKTTISAK
KQQ
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgaagagtactttgagtttaactttatgtgttatatcgcttctattaaccctttttctg
gcggccttggatattgttatagtggttactttatatgatacaattggcattaagttccat
gacttcggcaatattggttggttagttactggatatgctctttctaatgctgttttcatg
ttattatggggtcgcttggccgaaatacttggtacaaaggagtgcttaatgatttctgtt
attgtatttgaaatagggtctttgatttctgctctttcgaattcaatggcgactctgatt
agcggaagagtcgttgctgggtttggaggaagtggaattgaatcacttgcttttgtagtt
ggaacatccattgtccgagaaaaccatagaggaattatgataacggcactcgctatatcg
tatgtcattgcagagggagtcgggccttttattggtggtgcatttaatgaacatttgtct
tggagatggtgcttttatataaatcttccaatcggtgcgtttgcgttcataatattggca
ttttgtaacacatctggagaaccacatcaaaaaatgtggctaccatcaaaaatcaaaaaa
attatgaactatgactatggcgaattattgaaagcaagtttttggaagaatacatttgaa
gtacttgtatttaaactagacatggttgggattattttatcttcagcaggctttacacta
ctgatgttaggtctttcatttggtggaaacaacttcccatggaattcgggtatcattatt
tgcttttttaccgtgggccctatcttattgttactattttgtgcttacgactttcatttt
ctgtcattatcggggcttcactatgacaacaagcggatcaaaccgttactgacatggaat
attgcctcaaattgtggcatatttacaagctccataacaggattcctttcttgctttgct
tatgaattacagtctgcttatttagtccagctttatcaactagtatttaaaaaaaagcct
acattagcgagtatacatctttgggaactatcaattccagctatgattgcaactatggcc
atagcatatctaaattcaaaatatggcatcatcaaaccggcaattgtttttggtgtgctt
tgtgggattgttggatctggtttatttacgctaatcaatggcgaactctctcagtcaata
ggttattcaattctcccaggaatagcttttggtagtattttccaagcaacgttattaagc
tcccaggtgcagataacatcagacgatccagactttcaaaacaagtttattgaagtcaca
gctttcaactcgttcgccaaatccttgggctttgcgtttggagggaatatgggggcaatg
atattcactgcatcactcaaaaaccagatgcgctcttcccaattaaacataccacaattt
acgtctgtagaaacacttttagcgtatagcacagaacattatgatggcccccaatcttca
ctatcaaagttcataaacacagctatccatgacgttttttactgcgccttaggatgctat
gctctttcattcttctttggaatattcacttcgagtaagaaaacaacaatatcagccaaa
aagcaacaatga

DBGET integrated database retrieval system