KEGG   Streptococcus parasanguinis FW213: Spaf_0110Help
Entry
Spaf_0110         CDS       T02115                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain, putative
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00260  Glycine, serine and threonine metabolism
scf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
scf01100  Metabolic pathways
scf01110  Biosynthesis of secondary metabolites
scf01130  Biosynthesis of antibiotics
scf01230  Biosynthesis of amino acids
Module
scf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Spaf_0110 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Spaf_0110 (trpB)
Enzymes [BR:scf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Spaf_0110 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFJ25139
UniProt: I1ZJB5
Position
121680..122885
Genome map
AA seq 401 aa AA seqDB search
MAYKQPDKNGFYGRFGGRFVPETLMTAVLELEEAYRESQADPSFQAELDQLLKQYVGRET
PLYYAKNLTKYVGGAKIFLKREDLNHTGAHKINNALGQVLLAHRMGKKKIIAETGAGQHG
VATATAAALFDMECTIYMGEEDVKRQALNVFRMELLGAKVQSVTDGSRVLKDAVNAALRA
WVANVEDTHYIMGSALGPHPFPEIVRDFQSVIGREAKRQFAEQNDGALPDAVLACVGGGS
NAIGLFYPFVEDASIAMYGAEAAGLGVDTDQHAATLTKGRPGVLHGALMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSYFHDIKRATYVPVTDQEALEAFQLLSKVEGIIPALESSHAI
AYAVKLAKEMGPEKSMIVCLSGRGDKDVVQVKDRLEKERGE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcatataaacaaccagataaaaacggattttacgggcggttcgggggacgatttgtc
cctgaaaccttgatgacagcagttttagaattagaagaagcctatagagaaagtcaagca
gatccttcttttcaagcagaattggatcagcttctgaaacaatatgtcggtcgggaaaca
ccgctctattacgctaagaatctaaccaagtatgttggtggagccaagatttttcttaaa
agagaagacctcaaccacacaggggctcataaaattaataatgctctaggacaggttttg
ttggcacaccggatgggcaaaaagaagatcatcgcagaaacaggggccggacagcacggt
gttgcaacagcaacagctgctgctttatttgatatggaatgtaccatctacatgggggaa
gaagatgtcaaacgccaagccctcaatgtctttcggatggaattgttgggcgccaaggtt
caatcagtaacagatgggtcacgggttctcaaggatgcggtcaatgctgcccttagagcc
tgggtagcaaatgtggaggatacccactatatcatggggtctgctctagggcctcatcca
ttcccagagattgtccgtgattttcaaagtgtcatcggtcgagaagccaaacgccaattt
gcagagcaaaatgatggtgcgctaccagatgcagtcttagcctgtgtaggaggcggatcg
aacgccattgggctcttttatccttttgttgaggatgcctctattgccatgtatggggcg
gaagctgctggccttggggtagatacagaccagcatgcagcaaccttaaccaagggacgt
ccgggagtccttcacggcgccttgatggatgttttacaggatgcccatggacagatttta
gaagccttctcgatttcggcaggtctcgattatccagggattgggccagagcattcttat
ttccatgacatcaagcgggcaacctatgtgcctgtgacagaccaagaagccctagaagcc
tttcaattgctttcgaaagtagaaggaatcattccagctctggaatcgagccatgctatc
gcctatgcggtgaagttggctaaggagatgggacctgaaaaatctatgattgtttgctta
tcaggtcgtggggataaagatgtggtacaagtcaaagaccgcctagaaaaagagagagga
gagtaa

DBGET integrated database retrieval system