KEGG   Streptococcus parasanguinis FW213: Spaf_1954Help
Entry
Spaf_1954         CDS       T02115                                 

Gene name
galU
Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00040  Pentose and glucuronate interconversions
scf00052  Galactose metabolism
scf00500  Starch and sucrose metabolism
scf00520  Amino sugar and nucleotide sugar metabolism
scf01100  Metabolic pathways
scf01130  Biosynthesis of antibiotics
Module
scf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Spaf_1954 (galU)
   00052 Galactose metabolism
    Spaf_1954 (galU)
   00500 Starch and sucrose metabolism
    Spaf_1954 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Spaf_1954 (galU)
Enzymes [BR:scf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Spaf_1954 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AFJ26894
UniProt: I1ZPC0
Position
2000400..2001308
Genome map
AA seq 302 aa AA seqDB search
MTKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKA
KRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNDDALPLTKQLMNDYDETHASTIAVMEVPHEEVSSYGVIAPQG
EGINGLYSVETFVEKPNPEDAPSNLAIIGRYLLTPEIFAILENQEPGAGNEIQLTDAIDT
LNKTQRVFAREFTGDRYDVGDKFGFMKTSIDYALKHPQVKDDLKQYIIELGKELEASEKT
AD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagttagaaaagccgtcattcctgcggctggtttggggacacgcttcctcccg
gctactaaagccttggccaaggaaatgttgccaatcgttgacaaacctacgatccaattt
atcgtagaagaggctctgaaatctgggattgaggaaatccttgtcgtaacagggaaggct
aaacgttcgatcgaagaccatttcgattctaacttcgaattagaatacaatctcgagcaa
aaaggcaagactgacttactcaagttggtcaatgatacaacagcgatcaatcttcacttc
atccgccaaagtcaccctcgaggtttaggagacgcggttcttcaagcgaaggcctttgtt
ggaaacgagccttttgtcgtcatgctgggagatgacctcatggacatcactaatgatgat
gccttgccacttaccaaacaattgatgaacgactacgatgaaacccatgcgtcaactatc
gctgtgatggaagtccctcacgaagaggtttcttcttacggtgtgatcgcacctcaaggc
gaagggattaacggtctttatagcgttgaaacttttgtcgaaaaaccaaacccagaggat
gcgccaagtaatctcgctatcattggacgctacctcttaactcctgagatctttgcgatc
cttgaaaatcaagaaccaggcgctggaaatgaaattcaattgacggatgcgattgacacg
ctcaataaaacacagcgcgtctttgctcgtgaattcactggagatcgctatgacgtcggt
gataaattcggctttatgaaaacttcgatcgactatgccttgaaacaccctcaagtcaaa
gatgatctcaaacaatatattatcgaactcggaaaagaattagaagcgtctgaaaaaact
gcagactaa

DBGET integrated database retrieval system