KEGG   Streptococcus parasanguinis FW213: Spaf_1973Help
Entry
Spaf_1973         CDS       T02115                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
scf  Streptococcus parasanguinis FW213
Pathway
scf00230  Purine metabolism
scf00250  Alanine, aspartate and glutamate metabolism
scf01100  Metabolic pathways
Module
scf_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:scf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Spaf_1973 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Spaf_1973 (purA)
Enzymes [BR:scf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     Spaf_1973 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt DUF4375
Motif
Other DBs
NCBI-ProteinID: AFJ26911
UniProt: I1ZPD7
Position
complement(2020193..2021485)
Genome map
AA seq 430 aa AA seqDB search
MTSVVVVGTQWGDEGKGKITDFLSANAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF
FPEKISVIGNGVVINPKSLVKELAYLHEEGVTTDSLRISDRAHVILPYHIELDRLQEESK
GDNKIGTTIKGIGPAYMDKAARVGIRIADLLDRDVFAERLRINLEEKNRQFTKLYDAEAL
SFDDIFEEYYEYGQQIKQYVTDTSVILNDALDNGKRVLFEGAQGVMLDIDQGTYPFVTSS
NPVAGGVTIGSGVGPSKIDKVVGVCKAYTSRVGDGPFPTELFDEVGDRIREVGHEYGTTT
GRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGERIDHYPASL
EQLKRCKPIYEELPGWSEDITGVRHLDELPENARNYVRRVGELVGVRISTFSVGPDRDQT
NILESVWSSL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagtagttgtagtaggaacccaatggggtgatgaaggaaaagggaagattact
gacttcctatcagccaatgcagaagtcattgctcgctaccaaggtggggacaatgccggt
cacaccattgtgatcgacggcaaaaagttcaagttgcacttgattccttcaggtatcttc
ttccctgaaaagatttctgtcattgggaatggggttgtgatcaatcctaaatcattggtc
aaagagttggcgtatcttcatgaagaaggtgtgacaacagacagtttgcgcatttcagat
cgcgcccatgtcatcctcccttaccatatcgaattggaccgtctccaagaagaatctaaa
ggagacaacaagatcggaacgacgattaaagggattggcccagcctatatggacaaggct
gcacgtgtgggaatccggattgcggatctattggatcgcgacgtctttgcagaacgcctt
cgcatcaacttggaagaaaagaaccgtcaatttaccaaactctatgatgcagaggctctt
tcatttgacgatatcttcgaagaatactatgaatatggtcaacaaatcaagcaatatgta
accgatacttctgtcatcttgaacgatgctttggataacggcaagcgcgtgctctttgaa
ggagcccaaggggttatgttggatatcgaccaaggaacttatccatttgttacttcatca
aaccctgttgcaggtggagtgaccatcggatcaggtgtcggcccaagcaagatcgataag
gttgtcggtgtatgtaaagcctatactagccgtgtcggagatggcccattccctacggag
ctctttgatgaagtgggtgatcggattcgtgaagtcggtcatgagtatgggacaacaacc
ggtcgtccacgtcgtgtcggttggtttgactcagttgtcatgcgccatagccgtcgtgtc
tcaggaattactaaccttagcttgaactcgatcgacgttctatcaggcttggatacggtg
aaaatctgtgtagcctacgacttggatggggaacgcatcgaccactacccagcaagcttg
gagcaactcaaacgttgcaaaccaatctatgaagaattaccaggctggtcagaagacatc
acaggtgtccgccacttggatgagcttccagaaaatgcccgcaactatgtccgccgtgtc
ggtgaattagttggtgtgcgcatttcaaccttctcagtcggaccagatcgtgaccaaacc
aatatccttgaaagtgtgtggtctagtttataa

DBGET integrated database retrieval system