KEGG   Streptococcus constellatus subsp. pharyngis C1050: SCI_1459Help
Entry
SCI_1459          CDS       T02832                                 

Definition
(GenBank) putative farnesyl diphosphate synthase/geranyltranstransferase
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
scg  Streptococcus constellatus subsp. pharyngis C1050
Pathway
scg00900  Terpenoid backbone biosynthesis
scg01100  Metabolic pathways
scg01110  Biosynthesis of secondary metabolites
scg01130  Biosynthesis of antibiotics
Module
scg_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:scg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCI_1459
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:scg01006]
    SCI_1459
Enzymes [BR:scg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SCI_1459
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SCI_1459
    2.5.1.29  geranylgeranyl diphosphate synthase
     SCI_1459
Prenyltransferases [BR:scg01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SCI_1459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AGU80381
Position
complement(1509370..1510272)
Genome map
AA seq 300 aa AA seqDB search
MKQDEKLVRIGRTIENFYVQKMVSADLIEVILYSINAGGKRIRPLLLLELLEGMGLELTE
AHFQVAAALEMIHTGSLIHDDLPAMDDDDYRRGRLTSHKKFGEDMAILAGDSLFLDSYAL
VAEAALPSQIRANLIAELSQAAGTFGMVGGQVLDMQGEGRGVSLEELQVIHANKTGKLLT
YPFIAAGLIAELAEPQQEKLRKTGQLLGLAFQVRDDILDETASFEDLGKTPQKDVAAGKA
TYPAILGLDGAKHFFEEQLSAAEILLAEIEMDIDFSGSAIRKIIESLRLNDEGKSRCSSL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagacgaaaaattggttagaattggacggactattgagaatttttatgttcaa
aagatggtatcggctgatttgattgaagtgattctttactcaatcaatgcaggcggcaag
cggattcgccctctgctgcttttggaattgttagaaggtatgggtttggaattgacggag
gcccattttcaggtggccgcagcgcttgagatgattcatactggaagtttgattcatgac
gatttgccagctatggatgatgatgattatcgtcgtggtcgtttaaccagccacaaaaaa
tttggagaggatatggctattttagcaggggattcgctctttttggattcttatgcctta
gtagcagaagcggcattacctagtcagattagggcaaacttaattgcagaattatctcaa
gctgctggaacctttggcatggttggaggtcaagttcttgatatgcaaggagaaggtcgg
ggcgttagtttggaagagttacaggttattcatgctaacaaaactggtaagctcctgacc
tatccttttattgcagctggtttgattgctgaactagcagaaccgcagcaagaaaaatta
agaaaaacgggtcaattacttggactagcttttcaggtgcgagatgatattttagatgag
acagcgagctttgaggacttggggaagacaccacagaaagatgtagcagcagggaaggct
acttatccagctatcttgggcttggatggtgctaagcatttctttgaagaacagttgagc
gcagctgagattttattagcagagatagaaatggacatagatttttcagggtctgctatc
agaaaaataatagaaagtttgaggcttaatgacgaaggaaagagtagatgttctagctta
taa

DBGET integrated database retrieval system