KEGG   Sphingobium chlorophenolicum: Sphch_0221Help
Entry
Sphch_0221        CDS       T01522                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sch00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Sphch_0221
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sch02000]
    Sphch_0221
Enzymes [BR:sch01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Sphch_0221
Transporters [BR:sch02000]
 Other Transporters
  Pores ion channels [TC:1]
   Sphch_0221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AEG47921
UniProt: F6EUZ7
Position
1:complement(228480..229112)
Genome map
AA seq 210 aa AA seqDB search
MPHAITLYTNPMSRGQIARWMLEEVGQSYEMVVLDYGEGGMKSADYLAINPMGKVPAIVH
DGRTITECAAICAYLADAFPAANLAPPTDQRADYYRWLFFAAGPVEAAVTNKALGFTVPE
NRERTAGYGTFDHMVDTLERAVSGPAWICGDQFTAADVYVGAQIDWGLSFGTIPSRPAFE
AYASRLRERPAYRRQKDMDNALIAQMQKSA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccacatgccatcaccctctacaccaaccccatgtcgcgcggacagatcgcccgctgg
atgctggaggaagtcggccaatcctatgagatggtcgtgctggattatggcgaaggcggc
atgaagtccgccgattatctggcgatcaaccccatgggcaaggttcccgccatcgtccat
gacggcaggacgatcaccgaatgcgcggcaatctgcgcctatctggcggacgccttcccc
gccgcgaacctcgccccgccgacggaccagcgcgccgactattatcgctggctcttcttc
gccgccggtccggtggaagcggccgtcaccaacaaggcgctcggcttcaccgtccctgaa
aatcgcgagcgaacggcaggctacggcacgttcgaccatatggtcgacacgctggaacgc
gccgtctccggccccgcctggatttgcggcgaccagttcaccgccgccgacgtctatgtc
ggcgcgcagatcgactggggcctcagcttcggcacgatccccagccgccctgctttcgag
gcctatgcctcccgcctgcgcgaacgcccggcctaccggcggcagaaggatatggacaac
gccctcatcgcccagatgcagaaatccgcataa

DBGET integrated database retrieval system