KEGG   Sphingobium chlorophenolicum: Sphch_0995Help
Entry
Sphch_0995        CDS       T01522                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00071  Fatty acid degradation
sch00072  Synthesis and degradation of ketone bodies
sch00280  Valine, leucine and isoleucine degradation
sch00310  Lysine degradation
sch00362  Benzoate degradation
sch00380  Tryptophan metabolism
sch00620  Pyruvate metabolism
sch00630  Glyoxylate and dicarboxylate metabolism
sch00640  Propanoate metabolism
sch00650  Butanoate metabolism
sch00900  Terpenoid backbone biosynthesis
sch01100  Metabolic pathways
sch01110  Biosynthesis of secondary metabolites
sch01120  Microbial metabolism in diverse environments
sch01130  Biosynthesis of antibiotics
sch01200  Carbon metabolism
sch01212  Fatty acid metabolism
sch02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sphch_0995
   00630 Glyoxylate and dicarboxylate metabolism
    Sphch_0995
   00640 Propanoate metabolism
    Sphch_0995
   00650 Butanoate metabolism
    Sphch_0995
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sphch_0995
   00072 Synthesis and degradation of ketone bodies
    Sphch_0995
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sphch_0995
   00310 Lysine degradation
    Sphch_0995
   00380 Tryptophan metabolism
    Sphch_0995
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sphch_0995
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sphch_0995
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sphch_0995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sch04147]
    Sphch_0995
Enzymes [BR:sch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sphch_0995
Exosome [BR:sch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sphch_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEG48686
UniProt: F6EU57
Position
1:1081335..1082531
Genome map
AA seq 398 aa AA seqDB search
MRRAAIVAPIRTAVGKYGGSLKSMTAGDLGAVIIKALVERTKIDPERIDDVVFSQGYGNG
EAPCIGRWSALAAGLPESIPGVQLDRRCGSGLQAVIDAAMRIQTGAADMVIAGGVESMSN
VEYYSLDHRWGARSGSTQFHDRLTRGRVMSQPIERYGIISGMIETANNLARDYDISREAC
DEYAAMSHQRAAAAWKAGKFDDELVPVAVPQRKGEPVMFAKDEGIRADATPESLALLKPI
EKDGVVTAGNASQQNDAAAACLVVAEDRLSELGLEPMGFLHSWAAAGCDPSRMGIGPVPA
VERLFARNGLGWGDIDLVELNEAFAPQVLACLKGWNWDDRDKLNVNGSGISLGHPIGATG
GRILANLLRELRRRDGRYGLETMCIGGGQGLAAVFERA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagagccgccatcgtcgcccccatccgcaccgccgtcggcaaatatggcgggtct
ctcaagtccatgacggcgggcgatctgggcgccgtcatcatcaaggcgctggtggagcgc
acgaaaatcgacccggagcggatcgatgacgtggtgttcagccagggctatggcaatggc
gaggcgccctgcatcggccgctggtcggcgctggcggctggcctgccggaatccatcccc
ggcgtgcagttggaccgccgttgcggctccggcctgcaagcggtgatcgacgcggccatg
cgcatccagaccggcgcggcggacatggtgatcgcgggcggcgtggagagcatgtcgaac
gtcgaatattattcgctcgaccatcgctggggcgcgcggtctggttccacccagttccac
gaccgcctgacgcggggccgggtgatgtcccagccgatcgaacgatacggcatcatcagc
ggcatgatcgagacggccaacaacctcgccagggattacgacatctcccgcgaagcctgc
gacgaatatgccgcgatgagccaccagcgcgccgcagccgcctggaaagccgggaaattc
gatgacgaactggttcccgtcgccgtgccgcaacgcaagggcgaacccgtcatgttcgcg
aaggacgagggcatacgcgccgacgccacgccggaatcgctggcgctgctgaagcccatc
gagaaggacggcgtcgtcaccgcgggcaatgcgagccagcagaatgatgcggcggccgcc
tgtctggtggtggcggaggacaggctaagcgaactcggccttgaacccatgggtttcctg
catagctgggcggcggcgggctgcgacccgtcccgcatggggatcgggccggttccagcg
gtcgagcggctgtttgcgcggaacggacttggctggggggacatcgatctggtcgaactc
aacgaggccttcgcgccgcaggtgctggcctgcctcaagggctggaactgggacgaccgg
gacaagctgaacgtcaacgggtcgggcatttcgctgggccatccgattggggcaaccggc
gggcgcatccttgccaacctactgcgcgaattgcggcggcgcgacgggcgctatgggctg
gaaacgatgtgcatcggcggcggccaggggctggcggcggtgttcgagcgggcctga

DBGET integrated database retrieval system