KEGG   Sphingobium chlorophenolicum: Sphch_1450Help
Entry
Sphch_1450        CDS       T01522                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00790  Folate biosynthesis
sch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sphch_1450
Enzymes [BR:sch01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Sphch_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEG49139
UniProt: F6EY33
Position
1:complement(1568152..1569273)
Genome map
AA seq 373 aa AA seqDB search
MLPEIPADARLYLRPTWFVPTPIGLADGSAARMGNGLIWFQGYELTARKDGRRVARVTVP
VAEFADAVARLPDALAERALNLAANISAQRPPLVLERRTIRFDAPQVMAILNITPDSFSD
GGKHVGDPQAAADAGFAMAAAGAALIDVGGESTRPKAPKLWEGDEIARVVPVIEKLAAAG
VPISIDTRKAAVMEAALAAGAAVVNDVSALLHDPQAMEVAVSAGCPVILMHAPSSGDDPH
ANPDGYGDVVADVFDMLEARVAACLAAGVAREKIMVDPGLGFGKSLGDNLALVNGLAVFQ
GLGVPLLFAGSRKRLIGALSNEAPAAERLGGSVGLAFRAVELGAQMVRVHDVKESVQALH
LWRGLADAGLSAV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ttgttgcctgaaatccccgccgacgcccggctttacctgcggcccacctggttcgtgccg
acgcctatcggtctggccgacgggtcggcggcgcggatgggcaatgggttgatctggttt
cagggctatgaactgaccgcgcgcaaggacgggcggcgggtggcgcgggtgacggtgccg
gtcgcggagttcgccgatgccgtggcgcgcttgcccgatgcgctggcggagcgggcgctc
aaccttgccgccaatatctcggcgcagcggccgcctttggtgctggagaggcggacgatc
cgtttcgacgcgccgcaggtgatggcgatcctgaacatcacgcccgacagcttttccgac
ggcggcaagcatgtcggcgatccgcaggcggcggcggatgcgggcttcgccatggcggcg
gcgggggcggccctgatcgacgtgggcggggaatcgacccggcccaaggcgccgaagctg
tgggaaggggatgagatcgcccgcgtcgtgccggtgatagagaagctggcggcggcgggc
gtcccgatatccatcgacacgcgcaaggcggcggtgatggaggcggcgctggcggcgggg
gcggcggtcgtcaacgatgtgagcgcgctgctgcacgatcctcaggcgatggaggtggcg
gtctccgcaggctgtccggtgatcctgatgcatgcgccttcgtccggggacgatccgcac
gccaatcccgacggctatggcgatgtcgtggccgatgtgttcgacatgctggaggcgcgg
gtggcggcctgtctggcggccggggtggcccgcgagaagatcatggtcgatccgggattg
gggttcggcaagtcgctgggcgacaatctggcgctggtgaacggattggccgtgtttcag
gggctgggggtgccgttgctcttcgccgggagccggaagcggttgatcggggccttgtcc
aatgaggctccggcggccgaaaggctgggtggatcggtgggtctggccttccgcgccgtg
gaactgggcgcgcagatggtgcgggtgcatgatgtcaaggaaagcgtgcaggcgctgcat
ctgtggcgcgggctggccgatgcggggttgagcgcggtttga

DBGET integrated database retrieval system