KEGG   Sphingobium chlorophenolicum: Sphch_4031Help
Entry
Sphch_4031        CDS       T01522                                 

Definition
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00670  One carbon pool by folate
sch01100  Metabolic pathways
sch01120  Microbial metabolism in diverse environments
sch01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sch00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Sphch_4031
Enzymes [BR:sch01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Sphch_4031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AEG51610
UniProt: F6F244
Position
2:complement(1316598..1317470)
Genome map
AA seq 290 aa AA seqDB search
MKLAYADQHAPTVDLIQSFSLEMTAKDIESLTDAAPLIPAGTPISVTYLPGEEMPARVAA
AQAVKNLGFVPVPHISARRVLSRDDLQQFLAMLDEHVGIERAFVIAGDPASPMGPYEDAL
AIIRDGLLPAVGVRKVGISGYPEGHPDIDKPKLAKAMHDKIAALSDQGLEAEIMTQFAFD
ADAILVWLERIRQEGVTIPVRVGVPGPASVKKLVRFAARCGVGASAKVMLKYGTSITKLL
STAGPEKLIEELADRIDPSVHGDVLLHFYPFGAFVDTAQFIANHYGTAKA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgcctatgcggatcagcacgctcccaccgtggacctgatccagtccttctcc
ctcgaaatgaccgccaaggatattgagagcctgaccgacgccgcgccgctgatcccggcc
ggaacgccgatttccgtcacctatctgccgggcgaggagatgcccgcccgcgtcgccgcc
gcccaggcggtcaagaatctgggcttcgtgcccgtgccgcacatctccgcccgccgcgtc
ctgtcccgcgacgatctgcagcaattcctcgccatgctggacgaacatgtcggcatagag
cgggccttcgtcatcgcgggcgaccccgcgtcgcccatgggcccctatgaggatgcgctg
gcgatcatccgggacggcctgctgcccgcggtcggcgtccggaaggtcggcatttccggc
tatcccgaagggcatccggacatcgacaagcccaagctggccaaggcgatgcacgacaag
atcgccgccctgtcggatcaggggctggaggcggagatcatgacgcaattcgccttcgac
gcggacgccatcctcgtctggctggagcggattcgccaggaaggcgtcaccatccccgtg
cgcgtcggcgtgcccggcccggccagcgtcaagaagctggtccgtttcgccgcccgctgc
ggcgtgggcgcatcggcgaaggtcatgctgaaatacggcacctcgatcacgaagctgctg
agcacggccggtcccgaaaagctgatcgaggaactggccgaccgcatcgatccgtcggtc
catggcgacgtcctgctccatttctatccgttcggcgccttcgtcgacacggcgcagttc
atcgcgaaccactacggcaccgccaaagcctga

DBGET integrated database retrieval system