KEGG   Streptomyces collinus: B446_03465Help
Entry
B446_03465        CDS       T02787                                 

Definition
(GenBank) acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
sci  Streptomyces collinus
Pathway
sci00071  Fatty acid degradation
sci00410  beta-Alanine metabolism
sci00592  alpha-Linolenic acid metabolism
sci00640  Propanoate metabolism
sci01040  Biosynthesis of unsaturated fatty acids
sci01100  Metabolic pathways
sci01110  Biosynthesis of secondary metabolites
sci01212  Fatty acid metabolism
Module
sci_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B446_03465
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B446_03465
   00592 alpha-Linolenic acid metabolism
    B446_03465
   01040 Biosynthesis of unsaturated fatty acids
    B446_03465
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B446_03465
Enzymes [BR:sci01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     B446_03465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: AGS67525
UniProt: S5VGF9
Position
865740..867701
Genome map
AA seq 653 aa AA seqDB search
MPESGHYGGYGTLRPDGGPADGPSPADGPADALAAAGGDPALGTVAELTRLLFDGEDRER
GHGMWRDLISKDVFRHRPGLAAEERVALSYELLRLVNDTAGDAERLADDPRLLAALHEWA
AIVDGGGGLCTVASIHYNLFLGSLLDHGGATGRDLSDFTSLRRTGTFLCTELDHGNDASA
LETTAEPDPVTGGFVLHTPHEGAQKFMPNTSLTGGPKSAVVAARLIVEGQDEGVFLFLTP
LSDENGLLPGVRVRRLPLRTGAPVDHCLTAFDRVPLPRSALLESEHGRLDADGRLHSSLG
NRRKRFLRSIGRVTMGKLCMSGAAVGATRAALALAVRHGDLRQVSGPRAGERIPVNAHRP
HHGRLLKGVATGYAMTFLHRSALARWAAEHAGPDTGRRAEAERLVAIAKGWITWQARDIA
VECRERCGAQGLFAANGLSEFPHYIEGTITAEGDNLVIWVKAAAEMLFEHQPDRRDPEPP
GEVERLADPRHLLGLLARAEAVWQDRARTALRRGPSGDPVERWNGASSAALEMVSVHARL
RAAEAFLDAAAAARRPEARALLERLCLLFLLEQVGGHTGDLLADGHLSADQVRALPGFLD
DVVRDLAPRMTDLVDAFDLPAAYLDAIPLTASGQTRLTDHLTSEEAADWASER
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgccggagtccggccactacggcggatatggaacacttcgtccggacgggggtccggcg
gacggcccgtccccggcggacggccccgccgacgcgctcgccgccgccggcggcgacccc
gccttgggtacggtcgccgagttgacccggctcctgttcgacggcgaggaccgggagcgc
ggccacggcatgtggcgcgacctcatctccaaggacgtcttccgccaccgcccggggctc
gccgccgaggaacgggtcgcgctctcctacgagttgctgcgcctggtgaacgacacggcc
ggcgacgccgagcgactggccgacgacccgcggctcctggcggcgctgcacgagtgggcg
gcgatcgtggacggcggcggagggctgtgcacggtggcgagcatccactacaacctgttc
ctcggcagcctgctcgaccacgggggcgcgacgggccgggacctctccgacttcacgagc
ctgcgccgcaccggcacgttcctgtgcacggagctcgaccacggcaacgacgcctcggcc
ctggagaccaccgccgaaccggacccggtcaccggaggcttcgtgctgcacaccccgcac
gagggcgcgcagaagttcatgcccaacaccagcctcaccggcggcccgaagtccgcggtg
gtggccgcccggctgatcgtcgaggggcaggacgagggcgtcttcctgttcctgacgccg
ctcagcgacgaaaacggcctgctgcccggggtacgggtgcggcggctgccgttgcgcacc
ggcgcccccgtggaccactgcctgaccgcgttcgaccgggttccgctgccgcgtagcgcc
ctgctggagtccgagcacggccgcctggacgccgacggccgcctgcacagcagcctcggc
aaccggcgcaagcggttcctgcggtccatcggccgggtcacgatgggcaagctgtgcatg
agcggcgccgccgtcggcgcgacccgcgcggcgctcgccctggcggtcaggcacggcgac
ctccggcaggtcagcgggccgcgcgcgggcgagcgcatcccggtcaacgcccaccgcccg
caccacgggcggctgctgaagggcgtcgcgacgggctacgccatgaccttcctgcaccgc
tccgcgctcgcccgctgggcggcggagcacgccggtcccgacaccgggcggcgggcggag
gcggagcggctcgtcgcgatcgccaagggctggatcacctggcaggcccgggacatcgcc
gtcgagtgccgggaacgctgcggcgcgcagggcctgttcgcggccaacggcctgtccgag
ttcccgcactacatcgagggcaccatcacggccgagggcgacaacctggtgatctgggtg
aaggccgccgccgagatgctcttcgagcaccagccggaccggcgggaccccgaaccgccc
ggtgaggtggagcggctggcggacccccggcatctgctcggactgctggcccgggccgag
gccgtgtggcaggaccgggcccgcacggcactgcgccggggcccctccggggatccggtg
gagcggtggaacggtgcgtcctccgccgccctggagatggtctcggtgcacgcccggctg
cgggcggccgaggcgttcctggacgcggccgccgcggcccggcgccccgaggcccgcgcc
ctgctggagcgactgtgcctgctgttcctgctggagcaggtcggcgggcacacgggcgac
ctgctggccgacggccacctgtccgccgaccaggtacgcgccctgcccgggttcctggac
gacgtggtgcgcgacctcgccccccggatgacggatctggtcgacgcgttcgacctgccg
gccgcctacctggacgcgatccccctgaccgcctccggccagacccgcctcaccgaccac
ctcaccagcgaggaagcggccgactgggcgtccgagcggtag

DBGET integrated database retrieval system