KEGG   Streptomyces collinus: B446_06135Help
Entry
B446_06135        CDS       T02787                                 

Definition
(GenBank) ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
sci  Streptomyces collinus
Pathway
sci00998  Biosynthesis of secondary metabolites - other antibiotics
sci00999  Biosynthesis of secondary metabolites - unclassified
sci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    B446_06135
   00999 Biosynthesis of secondary metabolites - unclassified
    B446_06135
Enzymes [BR:sci01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     B446_06135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: AGS68051
UniProt: S5UQC9
Position
1480977..1482047
Genome map
AA seq 356 aa AA seqDB search
MTRPSSAADRSAAHQSAQVPSFAVISGNQVQRVLSGREKEIVELVEATYRLHGAGDSVNP
PSYFLRFPDRPNARIIALPASVGGSVHVDGLKWISSFPDNVRAGLPRASAVLILNDPVTG
YPFACLESSIISATRTAASAALAADWLSRSRPRPSRVGFFGTGLIARYIHTFLAGTGWTF
DTIGVHDLSTESAEGFRGYLRQADPAAQVTVHEHAEDLIRSSDLVVFATVAGEPHVDDPS
WFGHNPLVLHISLRDLAPEILLGSANFVDDVEHCLKADTSPHLAEQRTGDRDFLNGTLND
VMLGRAAPPADRPVIFSPFGLGVLDLAVGKYVYDEAAEAGDLRLIDDFFHDLRRYG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaccgtcgtcagcggccgaccgctcggccgcgcaccagtccgcccaggtgccc
tcgttcgcggtgatctccgggaaccaggtgcagcgggtcctcagcgggcgcgagaaggag
atcgtggagctggtcgaggccacctaccggctgcacggcgccggggactcggtcaacccg
ccgtcgtacttcctgcgcttccccgaccgcccgaacgcccggatcatcgcgctgcccgcc
tccgtcggcggctcggtgcacgtggacggcctcaagtggatctccagcttcccggacaac
gtgcgcgccgggctgccccgcgcctccgcggtgctgatcctcaacgaccccgtgacgggc
tatccgttcgcgtgtctggagagctccatcatcagcgccacccggaccgcggcctcggcc
gcgctggccgcggactggctcagccgctcccggccccggccgagccgggtcgggttcttc
gggacgggcctgatcgcccgctacatccacaccttcctggccggcacgggctggacgttc
gacacgatcggcgtgcacgacctgtccaccgagagcgccgagggcttccgcggctacctg
cgccaggccgacccggcggcgcaggtcaccgtccacgagcacgccgaggacctgatccgc
tccagcgacctcgtggtcttcgccacggtggcgggcgagccgcacgtcgacgacccgtcg
tggttcggccacaaccccctggtgctgcacatctcgctgcgtgacctggcgccggagatc
ctgctgggctcggcgaacttcgtcgacgacgtcgagcactgcctgaaggcggacacctcc
ccgcacctggccgaacagcgcaccggggaccgcgacttcctcaacggcaccctcaacgac
gtgatgctgggacgggccgccccgcccgccgaccggccggtgatcttctcgccgttcgga
ctcggcgtcctcgacctcgccgtcggcaagtacgtctacgacgaagcagcagaggcgggc
gacctccgcctcatcgacgacttcttccacgacctgcgccggtacggctga

DBGET integrated database retrieval system