KEGG   Streptomyces collinus: B446_18235Help
Entry
B446_18235        CDS       T02787                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
sci  Streptomyces collinus
Pathway
sci00310  Lysine degradation
sci01100  Metabolic pathways
sci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    B446_18235
Enzymes [BR:sci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     B446_18235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Lycopene_cycl Thi4 Pyr_redox_2 FAD_binding_2 Pyr_redox FAD_binding_3 Amino_oxidase Trp_halogenase HI0933_like Mqo NAD_binding_7 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AGS70463
UniProt: S5UTH3
Position
4195876..4197093
Genome map
AA seq 405 aa AA seqDB search
MVQVRDGAYDCDVLVVGGGIVGLSTAYAITRAAPGTRVTVLEKEPGPARHQTGRNSGVIH
SGIYYRPGSLKARYAVRGAAEMVKFCAEYGIAHAVTGKLIVATGRDELPRLHALVQRGRE
NGIPVRELGAAQIGEYEPEVRGLAAIHVGTTGVCDFVGVARQLARASGAEIRYGARIVRV
DRRPERGVAVLTAGGEVVRGRVLVNCAGLYCDEVARLAGDEPGVRIVPFRGEYYELARPE
LVRGLVYPVPDPAFPFLGVHLTRGIDGGVHVGPNAVPALAREGYGWGVVRPRELAGTVAW
PGSWVIARRHWRYGAGELRRSVSKGAFLQAVRRLLPAVEETDLVRAPAGVRAQAVLRDGT
LVDDFLIREGARTVHVLNAPSPAATASLPIGREVGRRALSMLAAT
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcaggtgcgggacggtgcgtacgactgcgacgtgctggtggtcgggggcgggatc
gtcgggctgtcgacggcgtatgcgatcacgcgggcggcgccgggtacgcgggtgaccgtg
ctggagaaggagccgggaccggcccggcaccagaccgggcgcaacagcggcgtcatccac
agcgggatctactaccgccccggctcgctcaaggcgcggtacgcggtgcggggcgccgcc
gagatggtgaagttctgcgccgagtacggcatcgcgcacgccgtcaccggcaagctgatc
gtcgccaccgggcgggacgagctgccgcggctccacgcgctcgtgcagcgcggccgggag
aacggcataccggtgcgcgagctgggcgccgcgcagatcggcgagtacgagccggaggtg
cgggggctcgccgcgatccacgtcggcacgaccggcgtgtgcgacttcgtgggcgtcgcc
cggcagctcgcccgggcgtcgggggcggagatccgctacggggcgcggatcgtgcgggtg
gaccgccggccggagcggggcgtggccgtgctgaccgcgggcggggaggtcgtgcgcggc
cgggtgctggtcaactgcgccgggctgtactgcgacgaggtggcgcggctggccggggac
gagcccggcgtgcggatcgtgccgttccgcggggagtactacgagctggcgcggcccgag
ctggtgcgcggtctcgtgtacccggtcccggacccggcgttccccttcctcggggtgcac
ctgacccgcgggatcgacggcggcgtgcacgtcgggcccaacgcggtgcctgcgctggcc
cgggaggggtacggctggggggtcgtgcggccccgggagctggccgggacggtggcctgg
ccggggtcctgggtgatcgcccggcggcactggcggtacggcgccggtgagctgcgccgc
tcggtgtccaagggggcgttcctgcaggcggtgcgccggctgctgccggcggtggaggag
acggacctggtccgggccccggccggggtgcgggcgcaggcggtgctgcgggacggcacc
ctggtggacgacttcctgatccgcgagggcgcccgcaccgtgcacgtgctgaacgcgccg
tcccccgcggccacggcctccctgccgatcggccgggaggtgggacgcagggcactgtcc
atgctggcggcgacgtga

DBGET integrated database retrieval system