KEGG   Streptomyces collinus: B446_30915Help
Entry
B446_30915        CDS       T02787                                 

Definition
(GenBank) glutamate dehydrogenase
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
sci  Streptomyces collinus
Pathway
sci00220  Arginine biosynthesis
sci00250  Alanine, aspartate and glutamate metabolism
sci00471  D-Glutamine and D-glutamate metabolism
sci00910  Nitrogen metabolism
sci01100  Metabolic pathways
sci01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sci00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    B446_30915
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B446_30915
   00220 Arginine biosynthesis
    B446_30915
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    B446_30915
Enzymes [BR:sci01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     B446_30915
Exosome [BR:sci04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   B446_30915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 3HCDH_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AGS72987
UniProt: S5VQW2
Position
complement(7148421..7149599)
Genome map
AA seq 392 aa AA seqDB search
MAAPLMSLVWTDHVTGRQGFLVVDRLVRGVASGGLRMRPGCTLEEVTGLARGMTMKEALH
YDPDARYVPLGGAKGGIDCDPRDPGAYGLLVRYLRAMRPYIESCWTTGEDLGLTQDLVDR
AAAEAGLVSSVQAVYPLLDDEAAARGRLADAFAVEVDGIGLDELAGGCGVAESVLTALDR
ASVPYRGTRVSVQGLGTMGGATARFLSRAGLTVVAVADVRGTMANPEGLDVEALLAARDA
YGTVDRAALRPGDRELPGDAWLSADAEVLVPAAVSYAVGAAEQGRVTARWIAEAANMPVR
PEAEAALAARGVTVLPDVVVNSATNAWWWWTLFGDIGADADEAFDRVRRSVRALTGQVLA
RAETGRTTARAAAHALAEDRLAALADRFGCYR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccccctgatgtcgctcgtctggaccgaccacgtcaccggccgccaggggttc
ctggtcgtcgaccggctggtgcggggcgtggccagcggcgggctgcgcatgcggcccggc
tgcacgctggaggaggtcaccggactcgcccgcggcatgacgatgaaggaggccctgcac
tacgaccccgacgcccgctacgtgccgctcggcggcgccaagggcggcatcgactgcgac
ccgcgcgacccgggggcctacggcctgctcgtgcgctacctgcgcgccatgcggccgtac
atcgagagctgctggaccaccggcgaggacctggggctcacccaggacctggtggaccgc
gcggccgccgaggcgggtctggtctcctccgtccaggcggtctatccgctgctggacgac
gaggcggcggcccgcggacggctcgccgacgccttcgcggtggaggtggacggcatcggc
ctggacgagctggccgggggctgcggggtggcggagtcggtgctgaccgccctggaccgg
gcgtcggtgccgtaccggggcacccgggtgtccgtgcagggcctgggcaccatgggcggg
gccacggcccgcttcctctcccgcgcgggcctgacggtggtggccgtggccgacgtgagg
ggaaccatggccaacccggagggcctggacgtggaggcgctgctggcggcgcgggacgcg
tacggcaccgtggaccgcgccgcgctgcgccccggcgaccgtgaactgcccggcgacgcc
tggctgtccgccgacgccgaggtgctggtgcccgcggcggtgtcgtacgccgtcggcgcc
gccgagcaggggcgcgtcaccgcccgctggatcgccgaggccgccaacatgccggtacgg
cccgaggcggaggcggcgctggccgcgcgcggggtgaccgtgctgccggacgtggtggtc
aactccgcgacgaacgcctggtggtggtggaccctcttcggcgacatcggcgcggacgcg
gacgaggcgttcgaccgcgtccgccgctcggtgcgcgccctgaccgggcaggtgctcgcc
cgcgcggagaccggccgcaccactgcgcgtgccgccgcccacgccctggccgaggaccgg
ctcgccgcgctggcggaccgcttcggctgctaccgctga

DBGET integrated database retrieval system