KEGG   Streptomyces collinus: B446_33880Help
Entry
B446_33880        CDS       T02787                                 

Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sci  Streptomyces collinus
Pathway
sci00625  Chloroalkane and chloroalkene degradation
sci00680  Methane metabolism
sci01100  Metabolic pathways
sci01120  Microbial metabolism in diverse environments
sci01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sci00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    B446_33880
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B446_33880
Enzymes [BR:sci01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     B446_33880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGS73576
UniProt: S5UJU0
Position
7927257..7928393
Genome map
AA seq 378 aa AA seqDB search
MKDVPDAKIEHPCDIIVKITTTNICGSDLHMYEGRTSFESGRTLGHENLGQVVEVGSAVR
KVQVGEYVVLPFNIACGFCKQCEQGLTNYCLTMQPEPALAGAAYGFADMGPYQGGQAELL
RVPYGDFNALRLGEDAAERQTDYVMLADIFPTGYHATEMAHVKPGDQTIVFGAGPVGLMA
TYSALLRGAGRVWTADHQPDRLRKAEEIGAIPINTAEQDPAQVVKEATLGLGADNGCECV
GYQAHDPQGHEDASLTLNGLIDSVRFTGHIGVVGVFLPQDPGGAEAQGELEAQGKVPIDF
GMMWFKGQHMGTGQAPVKRYNRALRDLIAGGKAKPSFVVSHELGLDEAPTAYEHFDARDD
GWTKVVLHPDGHGNGHKR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggacgtaccggacgcgaagatcgagcatccctgcgacatcatcgtcaagatcacc
acgaccaacatctgcggttcggacctgcacatgtacgagggccgcacctcgttcgagtcc
ggccgcaccctggggcacgagaacctgggccaggtggtggaggtcggctcggcggtgcgc
aaggtgcaggtcggcgagtacgtggtcctgcccttcaacatcgcctgcggcttctgcaag
cagtgcgagcagggcctgaccaactactgcctgaccatgcagccggaacccgccctcgcc
ggagcggcctacggtttcgccgacatgggcccctaccagggcggccaggcggagctgctg
cgcgtgccctacggcgacttcaacgcgctgcgtctgggtgaggacgccgccgagcggcag
accgactacgtgatgctcgccgacatcttccccaccggctatcacgccaccgagatggcc
cacgtcaagccgggtgaccagaccatcgtcttcggggccggtccggtcgggctgatggcg
acgtactccgccctcctccggggcgccggccgcgtctggacggccgatcaccagcccgac
cggctgcgcaaggcggaggagatcggggccatccccatcaacaccgccgagcaggacccg
gcgcaggtcgtcaaggaggccaccctcggtctgggcgccgacaacggctgcgaatgcgtc
ggttaccaggcccacgacccccagggccacgaggacgccagtctcacgctcaacggcctg
atcgactcggtcaggttcaccggccacatcggcgtggtgggcgtgttcctgccccaggac
cccggcggcgcggaggcccagggcgagctggaggcgcagggcaaggtccccatcgacttc
ggcatgatgtggttcaagggccagcacatggggaccgggcaggcgccggtgaagaggtac
aaccgggccctgcgggacctgatcgccggcgggaaggcgaagccgagcttcgtcgtctcc
cacgaactcggcctggacgaggcccccaccgcctacgagcacttcgacgcccgtgacgac
ggctggaccaaggtggtcctgcaccccgacggacacggcaacggccacaagcggtag

DBGET integrated database retrieval system