KEGG   Spiroplasma cantharicola: SCANT_v1c09960Help
Entry
SCANT_v1c09960    CDS       T04084                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
scj  Spiroplasma cantharicola
Pathway
scj00450  Selenocompound metabolism
scj00970  Aminoacyl-tRNA biosynthesis
scj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCANT_v1c09960 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SCANT_v1c09960 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:scj01007]
    SCANT_v1c09960 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:scj03016]
    SCANT_v1c09960 (metS)
Enzymes [BR:scj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SCANT_v1c09960 (metS)
Amino acid related enzymes [BR:scj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SCANT_v1c09960 (metS)
Transfer RNA biogenesis [BR:scj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SCANT_v1c09960 (metS)
 Prokaryotic type
   Other AARSs
    SCANT_v1c09960 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 DALR_2
Motif
Other DBs
NCBI-ProteinID: ALD66902
UniProt: A0A0M4KDA6
Position
complement(1153186..1154700)
Genome map
AA seq 504 aa AA seqDB search
MKKYFFVTTPIYYPSGNLHIGHAYTTTLADVISRYKKEDGFEVFFLTGSDEHGQKIEEKA
KEQNLKPKEYVDEIVKGFLNLWKLLNIDYTRFIRTTDEDHVVAVKEIFSDLLEKKLIYPS
TYKGKYCISCEEFLTKEQMDETFHHFVCGKEAKNFEEETYMLKVSSFKKYLQELFSTDFL
EPESRKKEMLNNFINNDLEDLSVTRVSFNWGIQIKENPKHVIYVWLDALSNYITALGYKS
KNNELLKKFWSKDTEILQIIGKEITRFHSIYWPVILNSLGLKTPDKLLSHGWILSGDKKM
SKSIGNVLDPIEIINTYSSDALRFYIINNLPTDKDGSFTNELFIESFNNNLANNIGNLIS
RVSNMIIKYFDGLLPIKKVSNHWLVKNAFDTIKNYKEKMDSYNMSEATQIVLKLAQECNK
FIEDSKPWTLEKENKLEELLEVLSVLQKNIVIISYLLKPILVNSYPNMINQMGLDPKDIN
FKNLEKDFKFKKIINKLVLFERIK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatttttttgtaacaacacctatatattatccaagtggaaatttacacata
ggacatgcttatacaacaacattagcagatgttatttcaagatataaaaaagaagacgga
tttgaagttttctttttgacaggttcagatgaacatggacaaaaaattgaagaaaaagca
aaagagcaaaatttaaaaccaaaagaatatgttgatgaaattgtaaaaggttttttaaat
ttatgaaaactattaaatatagattatactcgttttatcagaactactgatgaagaccat
gttgttgctgttaaagaaatttttagtgatttattagaaaaaaaattaatttatccttca
acttataaaggaaaatattgtattagttgcgaagagtttttaacaaaagaacaaatggat
gaaacatttcatcattttgtttgtggcaaagaagctaaaaattttgaagaagaaacatac
atgttaaaagtttcaagttttaaaaaataccttcaagagttattttctacagatttttta
gaacctgaatcaagaaaaaaagaaatgttaaataattttattaacaatgatttagaagat
ctctcagttacacgtgtaagttttaattgaggaattcaaataaaggaaaatccaaaacat
gtaatctatgtatgattagatgcactttcaaattacattacggctttaggctataaatca
aaaaataatgaacttttaaaaaaattttgatcaaaggatactgaaattttgcaaattatt
ggaaaagaaattacaaggtttcattcaatttattgaccagtaattttaaattcgcttggc
ttaaaaactccagataaattattatcacatggttgaattttaagcggtgataaaaaaatg
tctaaatctattggaaatgttttagatccaattgaaataattaatacatattcaagtgat
gctttaagattttatataataaataatttgcctacggataaagatggaagttttacaaat
gaattatttatagaatcatttaataataatttagcaaataatattggtaatttaatttca
agagtatcaaatatgattattaaatattttgatggactattgccaattaaaaaagtttca
aaccattgattagttaaaaatgcttttgatacaattaaaaattataaagagaaaatggat
agctataatatgtctgaagcaactcaaatagttttaaaacttgcacaagaatgcaacaaa
tttattgaagattcaaaaccttgaactttagaaaaagaaaataaacttgaggaactatta
gaagtactttctgttttacaaaaaaatattgttattatttcttacttattaaaaccaatt
cttgttaattcatatccgaatatgataaatcaaatgggattagatccaaaagatattaat
tttaaaaatttagagaaagatttcaagtttaagaaaataattaataaattagttttattt
gaaagaataaaataa

DBGET integrated database retrieval system