KEGG   Spiroplasma citri: SCITRI_00252Help
Entry
SCITRI_00252      CDS       T04628                                 

Gene name
marS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sck  Spiroplasma citri
Pathway
sck00450  Selenocompound metabolism
sck00970  Aminoacyl-tRNA biosynthesis
sck01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sck00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCITRI_00252 (marS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SCITRI_00252 (marS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sck01007]
    SCITRI_00252 (marS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sck03016]
    SCITRI_00252 (marS)
Enzymes [BR:sck01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SCITRI_00252 (marS)
Amino acid related enzymes [BR:sck01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SCITRI_00252 (marS)
Transfer RNA biogenesis [BR:sck03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SCITRI_00252 (marS)
 Prokaryotic type
   Other AARSs
    SCITRI_00252 (marS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e DUF5365 Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: APE74166
UniProt: Q14PR9
Position
212376..213956
Genome map
AA seq 526 aa AA seqDB search
MSQNKKLFYVTTPIYYPSAQLHIGHAYTTTLADILNRYKKMAGYETFFLTGSDEHGEKIE
KKAKTAGITPYQFITMIVDNFKLLWNKLGIEYSKFIRTTDKEHEVGVQKIFSKLYNNGDI
YLGEYEGLYCVSCEEFLTEAQIDKITNQCLVCGNKPQKVKEETYFFKVSKYSQFLINYYN
NHPGFIEPEARKNEMLNNFILPGLTDLSVTRTTFSWGIKTLENDKHIIYVWIDALSNYLT
ALGYLSNDDALFNKFWNNPDVEILQLLGKEIARFHTIYWPSMLESLGLRQPNKLLSHGWI
LFKDTKMSKSIGNVVDPLYLIDKYGRDTLRFYLGYEIPTENDGKFSYEMFLESYNAHLVN
NIGNLVSRVSNMISKYFNGQLVKQQQLDNVLIESCVQAVQNYQQAMDAYQISEGLSMILE
LCNKANKYIEENKPWELEKNKNMEQLHETLASLAYTIIVSAFLLQPVLVDNAQKIADYFN
VNLTNLTFKTILMQEIIYNKTIEKKENLFNRVNVEQELKQIETELN
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaacaagaaattattttatgttacaaccccaatttattatccaagcgcacaa
ttacatattggacatgcatataccacgacattagctgatattcttaatcgttataaaaaa
atggctggctatgaaactttctttttaacaggtagcgatgaacatggtgaaaaaattgaa
aagaaagcaaaaactgcgggaataacgccatatcaatttataacaatgattgttgataat
tttaaattattatgaaataaattaggaattgaatattcaaagtttattcgtaccactgat
aaagaacatgaagttggagtccaaaagatttttagtaaattatataataatggggatatt
tacttaggagagtatgaaggtttgtattgtgttagttgtgaagaatttttaactgaagca
caaattgataagataacaaaccaatgtttagtttgtggtaataagccacaaaaagtaaaa
gaagaaacatatttcttcaaagtctcaaaatatagtcaatttttaattaattattataat
aatcaccccggttttattgagccagaagcaagaaaaaatgaaatgttaaataattttatt
ttaccgggcttaactgatttatctgttactagaacaactttttcttggggaattaaaaca
ttagaaaatgataaacacattatttatgtttgaattgatgccttatcaaattatttaaca
gcattaggttatttgtcaaatgatgatgcattgtttaataaattttgaaataatccggat
gttgaaattttacaattattaggaaaagaaattgctcggtttcacactatttattgacca
agtatgttagaaagtttaggattacggcaacctaataaacttttatcgcatggttgaatt
ttatttaaagatactaaaatgagtaaatcaattggaaatgttgttgatccattatattta
attgataaatatgggcgtgatacattacggttttatttaggatatgaaattccaactgaa
aatgatggtaaattttcttatgaaatgtttttagaatcatacaatgctcatttagtcaac
aatatcgggaacttggtatcacgagtaagtaatatgattagcaaatattttaatggacag
ttagtaaaacaacaacaattggataatgtattaattgaaagttgtgttcaagcggtgcaa
aattatcaacaagcaatggatgcttatcaaatttcagaaggattaagcatgattttagaa
ctatgtaataaggcgaataaatatattgaagaaaataaaccttgggaattagaaaaaaac
aaaaatatggagcaattacatgaaactttagcaagtttagcttatactattatcgttagc
gcctttttattgcagccagttttagttgataatgcccaaaagattgccgattattttaat
gttaatttaactaatttaacatttaaaacaattttaatgcaagaaatcatatataataaa
acgatagagaaaaaagaaaacttatttaatcgtgttaatgtagaacaagaattaaaacaa
attgaaacagaattaaattaa

DBGET integrated database retrieval system