KEGG   Sorangium cellulosum So ce56: sce0048Help
Entry
sce0048           CDS       T00634                                 

Definition
(GenBank) enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00071  Fatty acid degradation
scl00280  Valine, leucine and isoleucine degradation
scl00281  Geraniol degradation
scl00310  Lysine degradation
scl00362  Benzoate degradation
scl00380  Tryptophan metabolism
scl00410  beta-Alanine metabolism
scl00640  Propanoate metabolism
scl00650  Butanoate metabolism
scl00903  Limonene and pinene degradation
scl00930  Caprolactam degradation
scl01040  Biosynthesis of unsaturated fatty acids
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01120  Microbial metabolism in diverse environments
scl01130  Biosynthesis of antibiotics
scl01200  Carbon metabolism
scl01212  Fatty acid metabolism
Module
scl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    sce0048
   00650 Butanoate metabolism
    sce0048
  Lipid metabolism
   00071 Fatty acid degradation
    sce0048
   01040 Biosynthesis of unsaturated fatty acids
    sce0048
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    sce0048
   00310 Lysine degradation
    sce0048
   00380 Tryptophan metabolism
    sce0048
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    sce0048
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    sce0048
   00281 Geraniol degradation
    sce0048
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    sce0048
   00930 Caprolactam degradation
    sce0048
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     sce0048
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     sce0048
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     sce0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: CAN90204
UniProt: A9GKZ3
Position
complement(64837..67065)
Genome map
AA seq 742 aa AA seqDB search
MTTTSAAATPAPAAASPLSLEVRPDGVAVVTYDVPGEAVNTLKPTFTGDLERIAGQIASN
PLIKAAILVSGKADTWIAGADIEMLKGVATAAEAEAMCRAGHEAILRIVRSPKPIVAAIH
GAALGGGLEVALACHARVLSDDRKTVLGLPEVQLGLLPGINGLQRLAERAGLKAALDHGL
TGKNMRPSKARQLGVADDVVPAAILREMAAALALKLARVEAGPPFRPKRASAPKLDSAAL
TRAALERNPIGRALLFQQAARQTRKKTGGHYPAPERIIDVLRTYAEKGFEASKEVEARAF
GELVASSTAHRLMELFFATNAMKKDTGVDDPAVQPRKVEKIAMIGAGLMGAGIAYVSLNA
GISVRLRDRDDASIGRGLKYVADILGERVKKKQLTPLERDEKLALLTATTDGSGLRSADL
VIEAVFEELAVKQAVLRDVEQHGKDGVIFASNTSSIPISRIAAASKRPENVVGMHYFSPV
HKMPLLEVIQTEATSPEVVATAVAVGKRQGKTVIVVNDGVGFYTSRILGPYMNEASWLLA
EGVAVEQVDAALVAWGWPVGPLALLDEVGIDVAAHVGPIMLEAFGDRLAPPPTMARLVSD
DRRGRKNERGMYLYGAAAKKKGKGKHADESVYGVLGLPVPRAKDGPPVPIEEIQLRCSLQ
LVNEALHCLGEGILRSPRDGDIGAIFGLGFPPFRGGPFRYVDGLGAAEVLRRIEIYERRF
GKRWTPAPALVEAARTGKPFYG
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacatccgccgccgccacgccggcccccgcggccgcgagcccgctctctctc
gaggtgcgccccgacggcgtggccgtcgtcacctacgatgtcccgggcgaggcggtcaac
acgctgaagcccacgttcaccggcgatctcgagcggatcgcgggccagatcgcgagcaac
ccgctcatcaaggcggcgatcctcgtgtccggcaaggccgacacctggatcgcgggcgcc
gacatcgagatgctgaagggcgtcgccacggcggccgaggccgaggcgatgtgccgcgcc
ggccacgaggcgatcctgcggatcgtgcgctcgccgaagccgatcgtcgccgcgatccac
ggcgccgcgctcggcggcggcctcgaggtggcgctcgcctgccacgcccgggtgctgagc
gacgaccggaagacggtgctcggcctgcccgaggtgcagctcggcctgctccccgggatc
aacgggctccagcggctcgcggagcgcgccggcctgaaggcggcgctcgaccacggcctc
accggcaagaacatgcgcccctcgaaggcgcggcagctcggcgtcgccgacgacgtcgtc
cccgcggccatcctgagggagatggccgcggcgctcgcgctcaagctcgcgcgtgtcgaa
gccggcccgccgttccggccgaagcgggcgagcgcgccgaagctcgactccgccgcgctc
acccgcgcggccctggagcggaacccgatcggccgcgccctgctcttccagcaggcagcg
cggcagacgcgcaagaagaccggcgggcactacccggcgcccgagcggatcatcgacgtg
ctgaggacgtatgcggagaagggcttcgaggcgtcgaaggaggtcgaggcgcgcgcgttc
ggcgagctcgtcgcgtcgagcacggcgcaccggctgatggagctcttcttcgcgacgaac
gcgatgaagaaggacaccggcgtggacgaccccgcggtgcagccgaggaaggtcgagaag
atcgcgatgatcggcgccggcctgatgggggccggcatcgcctatgtcagcctgaacgcc
ggcatctccgtgcggctccgggaccgcgacgacgcgtcgatcggccgcgggctcaagtac
gtggccgacatcctcggcgagcgggtgaagaagaagcagctcacgccgctggagcgcgac
gagaagctcgcgctgctcaccgcgacgacggacggctcgggcctccggagcgccgatctg
gtgatcgaggcggtgttcgaggagctcgctgtgaaacaagcggtcctgcgggacgtcgag
cagcacggcaaggacggggtgatcttcgcgtcgaacacgtcgtcgatcccgatctcccgg
atcgcggccgcgtcgaagcggccggagaacgtggtcgggatgcactacttcagcccggtg
cacaagatgccgttgctcgaggtcatccagaccgaggcgacgtcgcccgaggtggtcgcg
acggcggtcgcggtcggcaagcgccagggcaagacggtcatcgtcgtgaacgatggagtc
ggcttctacacgagccggatcctcgggccgtacatgaacgaggcgagctggctgctcgcc
gagggggtcgcggtcgagcaggtcgacgcggcgctcgtcgcgtggggctggccggtcggc
ccgctcgcgctgctcgacgaggtgggcatcgacgtggcggcccacgtcggcccgatcatg
ctcgaggcgttcggcgaccgcctcgcgccgcctcccacgatggccaggctggtgtccgac
gaccggaggggccgcaagaacgagcgcgggatgtacctgtacggcgctgcggcgaagaag
aagggcaagggcaagcacgccgacgagagcgtctatggcgtgctcgggctgccggtgccg
agggcgaaggacggcccgccggtgccgatcgaggagatccagctgcgctgctcgctccag
ctcgtgaacgaggcgctgcactgcctcggcgaggggatcctccggagcccgcgcgacggc
gacatcggcgcgatcttcggcctgggtttcccgccgttccgcggcgggccgttccgctac
gtcgacggcctcggcgccgcggaggtgctccgccgcatcgagatctacgagcgccgcttc
ggcaagcgctggacgcccgccccggccctcgtcgaggcggcgaggaccgggaagcccttc
tacggctga

DBGET integrated database retrieval system