KEGG   Sorangium cellulosum So ce56: sce0127Help
Entry
sce0127           CDS       T00634                                 

Gene name
metG1
Definition
(GenBank) High confidence in function and specificity
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00450  Selenocompound metabolism
scl00970  Aminoacyl-tRNA biosynthesis
scl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    sce0127 (metG1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    sce0127 (metG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:scl01007]
    sce0127 (metG1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:scl03016]
    sce0127 (metG1)
Enzymes [BR:scl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     sce0127 (metG1)
Amino acid related enzymes [BR:scl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   sce0127 (metG1)
Transfer RNA biogenesis [BR:scl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    sce0127 (metG1)
 Prokaryotic type
   Other AARSs
    sce0127 (metG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 zf-RRPl_C4
Motif
Other DBs
NCBI-ProteinID: CAN90284
UniProt: A9GLJ7
Position
complement(178072..180162)
Genome map
AA seq 696 aa AA seqDB search
MASRFYVTTPIYYINDVPHLGTAYTTIAADVLCRYHRLRGHESRMLTGTDEHGLKIQRAA
EARGVAPGAHADEIAAVFRATWPKLGCAPDDFIRTSEPRHKKAVQELWSRIKARGDIYLG
HYEGLYCVGCEAYYTEKDLEQPGNVCPLHKKPAESVKEESYFFRLSRYGDALLDYYKRNP
TFVQPASRLNEVVSFVREGLQDLSVSRTTFEWGIPVPDDPKHVMYVWFDALANYMTALRE
PEDNTRFWPADVHLVGKDILRFHAVYWPAFLLSAGYGEAELPRQVFAHGFLTYSGQKMSK
TLRNTISPVEVATALSEAAAAALPGGPGAAAGAPLVGVDVVRYCLMRAISFGQDGDFSLQ
DVLSRYGSELGNALGNLLNRVLPFAEEVPAKGALGPLEEELAGAQRQAAAAAATAFDANQ
PTRALDAIWTVIAAANLYIDKAAPWVAKKTDPARLGTIIATLIEQLEAISVMISPVMPVV
AGRMREQLGLPPIAFEEGSDRWPMALPSRAPGEKLHRGSPIFPRLEKEKEAELLARFAPP
RPDAEPGKADAKAGAKVDAQAGAKADSKAAPAASGGAEVAAPPARQGKSPVAFDDFARLD
LRIGVVTSAERVKKKDRLLDLRVDTGDGAPRRIISGIAASYAPEELVGKRIVVICNLPPR
DFGKGLVSEGMLLTAEVEGRVRTITVEDAAPGTPVF
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccgcttctacgtcacgacgcccatctattacatcaacgacgtcccccacctc
ggcaccgcctacacgacgatcgccgcggatgtgctgtgccgctaccaccggctgcgcggc
cacgagagccgcatgctcaccggcacggacgagcacggcctcaagatccagcgcgccgcc
gaggcgcgcggcgtcgcgccgggcgcccacgccgacgagatcgccgccgtcttccgcgcc
acgtggccgaagctcggctgcgctcccgacgacttcatccgcacgagcgagccgcgccac
aagaaggccgtgcaggagctctggagccggatcaaggcgcgcggggacatctacctcggc
cactacgaggggctctactgcgtcgggtgcgaggcctactacaccgagaaggatctggag
cagcccgggaacgtctgcccgctgcacaagaagcccgccgagagcgtcaaggaagagagc
tacttcttccgcctgtccaggtacggagacgcgctgctcgattactacaagcgcaacccg
accttcgtgcagccggcgagccgcctgaacgaggtggtgagcttcgtgcgcgagggtctc
caggatctgtcggtctcccgcaccacgttcgagtggggcatccccgtccccgacgacccg
aagcacgtcatgtacgtctggttcgacgcgctggcgaactacatgaccgccctccgggag
ccggaggacaacacgcgcttctggcccgcggacgtgcacctcgtcggcaaggacatcctg
cgcttccacgccgtctactggcccgcgttcctgctctcggcgggctacggcgaggcggag
ctgccgcgccaggtcttcgcccacgggttcctcacgtacagcgggcagaagatgtcgaag
acgctccgcaacacgatcagccccgtcgaggtggcgaccgccctctccgaggcagccgcg
gcggccctgcccggcggcccgggcgcggcggccggcgcgcccctcgtcggggtggacgtg
gtgcggtattgcctgatgcgcgcgatctcgttcggccaggacggcgacttcagcctccag
gacgtgctgtcgcggtatggctcggagctcggcaacgcgctcggcaacctgctgaatcgc
gtgctcccgttcgccgaggaggtccccgcgaagggggcgttgggcccgctcgaggaggag
ctcgccggggcgcagcggcaggccgcggcggccgcggcgacggcgttcgacgcgaaccag
ccgacgcgcgcgctcgacgcgatctggacggtgatcgccgcggcgaacctctacatcgac
aaggccgctccgtgggtggccaagaagacggacccggcgcgcctcgggacgatcatcgcg
acgttgatcgagcagctcgaggcgatcagcgtgatgatttcccccgtgatgccggtcgtg
gcgggcaggatgcgcgagcagctcgggctgccgccgatcgcgttcgaggagggcagcgat
cgctggccgatggcgctcccctcgcgagcgccgggcgagaagctccacaggggctcgccc
atcttcccgcgcctcgagaaggagaaagaggccgagctgctcgcccggttcgccccgccg
cggccggacgccgagccggggaaggccgacgcgaaggctggcgcgaaggtcgatgcgcag
gccggcgcgaaggccgattcgaaggccgcgcccgcggcgagcggcggcgccgaggtggcc
gccccgccggcgcgccagggcaagagccctgtggcgttcgacgatttcgcccggctggac
ctccggatcggcgtggtcacgagcgctgagcgcgtgaagaagaaggaccggctgctcgat
ctgcgggtcgacaccggcgacggcgctccgcggcgcatcatctcgggcatcgcggcgagc
tacgccccggaagagctggtgggcaagcggatcgtcgtcatctgcaacctgccgccgcgc
gacttcggcaaagggctcgtgtccgaaggcatgctgctgaccgccgaggtcgaggggcga
gtccgcaccatcacggtcgaggacgccgcgccgggcacgccggtgttctga

DBGET integrated database retrieval system