KEGG   Sorangium cellulosum So ce56: sce1220Help
Entry
sce1220           CDS       T00634                                 

Definition
(GenBank) similar to Xaa-His dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00300  Lysine biosynthesis
scl01100  Metabolic pathways
scl01120  Microbial metabolism in diverse environments
scl01230  Biosynthesis of amino acids
Module
scl_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    sce1220
Enzymes [BR:scl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     sce1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 PUMA
Motif
Other DBs
NCBI-ProteinID: CAN91377
UniProt: A9F1L9
Position
1688212..1690068
Genome map
AA seq 618 aa AA seqDB search
MRLSRLVHVGWIVVAALAYGACREDDASSPAPAAGAPACAHVDAELEASFHALARLVAAE
TYRAEQFANEDAFVASMQAIVDDLNAQAQQFNEGQRTHRIEPWEWKVESGNAAEPRYYWV
FGFRLGNGPRKISLNTHFDTVSPGDTDVWEPFVLTKSRGETKHGGEQELWVGRGAIDDKG
PALATFLVLKDIARAYDGSPLLDDITVELIFDTTEEIGAMSMRRYREENAGEAADLEIIF
DTFWAVRAEKGIERPVFTVPREAPPTAGVWIDSLNTPSGPVNQLPDRAEAILRGDSPAAL
EELALHIEADYADHPFDDPSYRRAELTVDTSGLPDALKLTTLVAGAQHASVPQENRANGA
NPLVSLTNFLGALAEEQVLADNDVARMCRFIKSTWGTKTFGETHPELLERHDEVFTEGNG
TTYALTRLYTEPSPGAITLHLDVRYAIGHHGQPWDGESEGLLCGDASEFAGIFGQIVDEF
NATSGGAPITFETVTRVAPDIRRVDGPTFSRISRAFEEVTGKPAPAVAMGAGTDAKAYVK
AIAAGALFDTTFGAPVNYHGIREAAPVRDLALSTKILCGVVEQEIKQAKEQHPEPVAGVC
EASSARKRSSAVDDGHDH
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgagtagactggttcatgtgggctggattgtcgtcgccgcgctggcgtacggc
gcctgccgggaggacgatgcttcgagcccggcgcccgccgccggcgcgccggcctgcgct
cacgtcgacgccgagctcgaggcgagcttccacgcgctggccaggctggtcgccgccgag
acctaccgcgccgagcagttcgcgaacgaggacgcgttcgtcgcgagcatgcaggcgatc
gtcgatgacctgaacgcccaggcgcagcagttcaacgagggtcaaaggacccacaggatc
gagccgtgggagtggaaggtcgagagcggcaacgcggcggagcccaggtactactgggtc
ttcgggttccgtcttggcaatgggccccggaagatctccctgaacacgcacttcgatacg
gtgtctccgggggacaccgacgtgtgggagccgttcgtgctgacgaaatcgaggggcgag
accaagcacggcggcgagcaggagctgtgggtcggccgcggcgccatcgacgacaagggg
ccggcgctggcgacgttcctcgtgctcaaggacatcgcccgggcctacgacggcagtccc
ctgctcgacgacatcacggtggagctcatcttcgataccaccgaggagatcggcgccatg
tcgatgcggcgctaccgcgaggagaacgccggggaggcggcggacctcgagatcatcttc
gacacgttctgggccgtgcgcgcggagaagggcatcgagcgccccgtgttcacggtcccg
cgcgaggcgccgcccacggcgggcgtgtggatcgactcgctgaacaccccctccggcccc
gtcaaccagctccccgaccgggccgaggcgatcctccgcggcgattcacccgcggcgctc
gaggagctcgccctgcacatcgaggcggactacgccgatcatccgttcgacgatccgtcg
tacaggcgggccgagctcacggtcgacacgtccggcctgccggacgcgctcaagctgacg
accctggtggcgggcgcgcagcacgcgtccgtgccccaggagaaccgcgcgaacggcgcc
aatccgctcgtgtcgctcaccaatttcctgggcgcgctcgcggaggagcaggtcctcgcc
gacaacgacgtcgcccggatgtgcaggttcatcaagtccacctggggcacgaagacattc
ggggaaactcaccccgagctgctcgagcgccacgacgaggtgttcaccgagggcaacggc
accacctatgcgctgacccggctgtacaccgagccgtcgcccggggcgatcacgctccac
ctcgacgtccggtacgcgataggccaccacggccagccgtgggacggggagagcgagggg
ctcctttgcggagacgcgagcgagttcgccggtatcttcgggcagatcgtcgacgagttc
aacgccacctccggcggcgcgccgatcacgttcgagaccgtcacccgggtcgcgccggac
atccgccgggtcgacggccccaccttcagccggatcagccgcgcgttcgaggaggtgacc
ggcaagcccgcgcccgcggtggccatgggcgcgggcaccgacgccaaggcgtacgtgaag
gcgatcgccgcgggcgcgctgttcgacaccacgttcggcgccccggtcaattaccatgga
atcagggaggccgcgccggtccgcgatctcgcgctgagcaccaagatcctctgcggcgtc
gtcgaacaggagatcaagcaagcgaaggagcagcacccggagccggtggctggcgtgtgc
gaggcctcctctgcgcgcaagcgctcctccgccgtggacgacggccacgaccattga

DBGET integrated database retrieval system