KEGG   Sorangium cellulosum So ce56: sce1599Help
Entry
sce1599           CDS       T00634                                 

Gene name
cheB
Definition
(GenBank) putative Chemotaxis response regulator CheB type
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl02020  Two-component system
scl02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:scl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    sce1599 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    sce1599 (cheB)
Enzymes [BR:scl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     sce1599 (cheB)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     sce1599 (cheB)
Two-component system [BR:scl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   sce1599 (cheB)
Bacterial motility proteins [BR:scl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    sce1599 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg X
Motif
Other DBs
NCBI-ProteinID: CAN91757
UniProt: A9FDF6
Position
2183609..2184691
Genome map
AA seq 360 aa AA seqDB search
MTFAPLRVLVVDDSAYNRRNIAEILSGSDEIEVVGKAGDGDDALRQAAQLRPDAITLDLE
MPRMDGFTFLRILMARQPTPVIIVSSYSHKENVFKALELGAVDFVAKPDRQFTADAQIRR
EIIQKVLLVRYLRPRSPMPAAPAPARPAQPASPRAVQESSRLGVSLRHLVAVGSSTGGPT
ALLEIFNRIPDRFPGAIFIAQHMPDKFTRTFAERLDRKGGLRVVEAQNGEQVVARKAYVC
PGRMCMEIAVTPGSGVGLSGDIRIRVGAPAPGDRYVPSADRLFRSVAQVGGSRAVGIILT
GMGDDGVNGARAVRAAGGTVVAESEDSAVVYGMPGAAVRAGVVNESLPFTAIGDFIALLS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgctcccctgcgcgtgctcgtcgtcgacgactccgcgtacaaccggcgcaac
atcgccgagatcttgagcggaagcgacgagatcgaggtcgtgggcaaggccggtgacggc
gacgacgcgctccgtcaagccgcgcagctccggccggacgcgatcacgctggatctcgag
atgccgcgcatggacggattcaccttcctccgcatcctgatggcgaggcagccgacgccc
gtcatcatcgtctcgagctacagccacaaggagaacgtcttcaaggcgctcgagctgggc
gccgtcgacttcgtggccaagccggaccggcagttcacggcggacgcgcagatccggcgg
gagatcatccagaaggtcctgctggtgcgctacctccgcccccgctctccgatgcctgcc
gcgccggccccggcgcggccggcgcagcctgcgtcgccgcgcgcggtgcaggagtcgtcg
cggctcggcgtctcgctgcgccacctcgtggcggtcggctcgtcgacgggcgggcccacg
gcgctcctcgagatcttcaaccggatcccggatcgtttccccggcgcgatcttcatcgcg
cagcacatgccggacaagttcacccggacgttcgcggagcggctcgatcggaagggcggc
ctccgggtggtcgaggcgcagaacggcgagcaggtggtggcccggaaggcctatgtgtgc
ccgggtaggatgtgcatggagatcgcggtgacgccgggcagcggggtcgggctgagcggc
gacatccggatccgggtgggggcgccggcgcctggggatcggtacgttccgagcgcggac
cggctgttccggagcgtggcgcaggtgggcggcagccgcgcggtgggcatcatcttgacg
gggatgggcgacgacggggtgaacggcgcgcgggcggtccgcgcggccgggggcacggtg
gtggccgagagcgaggactcggcggtggtctacggcatgcccggggccgcggtgcgggcc
ggggtcgtgaacgagagcctgcccttcacggcgatcggcgatttcatcgcgctgctttcc
tga

DBGET integrated database retrieval system