KEGG   Sorangium cellulosum So ce56: sce1990
Entry
sce1990           CDS       T00634                                 

Gene name
rrmJ
Definition
(GenBank) Family membership
  KO
K02427  23S rRNA (uridine2552-2'-O)-methyltransferase [EC:2.1.1.166]
Organism
scl  Sorangium cellulosum So ce56
Brite
KEGG Orthology (KO) [BR:scl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:scl03009]
    sce1990 (rrmJ)
Enzymes [BR:scl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.166  23S rRNA (uridine2552-2'-O)-methyltransferase
     sce1990 (rrmJ)
Ribosome biogenesis [BR:scl03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    sce1990 (rrmJ)
SSDB
Motif
Pfam: FtsJ Methyltransf_23 Methyltransf_31 Methyltransf_25 Methyltr_RsmB-F MetW
Other DBs
NCBI-ProteinID: CAN92149
UniProt: A9FQE4
Position
2700859..2701497
AA seq 212 aa
MPAERPSVSQKPKNPYKRPDAFTKAAKAQGYPARSVFKLEEIDRRVRLLRPGQRVLDLGA
APGSWSMYAAQRIGAGGKLLAVDLSPITAAFGPQATVVQGDALSLTNEALAQFAPYDVVL
SDMAPATSGSKIADQARSYELFMRAVAVAEALLAPGGAFVGKIFMSEDFVKARDALRNLC
EEVRSIRPEGTRASSVEIFLVGLKRKAAGKTG
NT seq 639 nt   +upstreamnt  +downstreamnt
gtgcccgccgagcgtccctccgtgtcgcagaagccgaagaacccgtacaagcggcctgac
gccttcacgaaggcggcgaaggcgcagggctatcctgcgcgcagcgtcttcaagctcgag
gagatcgatcgccgggtgcggctgctccgccctggccagcgggtgctcgacctgggcgcc
gcgccggggtcgtggtcgatgtacgcggcgcagcggatcggcgcggggggcaagctgctc
gcggtggatctgtcgccgatcacggcggcgttcgggccgcaggcgacggtggtgcagggg
gacgcgctgtcgctcacgaacgaggcgctcgcgcagttcgcgccgtacgacgtggtgctg
tcggacatggcgcccgcgacgagcggcagcaagatcgccgaccaggcccggagctacgag
ctgttcatgcgcgccgtggccgtggccgaggcgctgctcgcgccgggcggggcgttcgtc
gggaagatcttcatgagcgaggacttcgtgaaggcccgggacgcgctgaggaacctctgc
gaggaggtccggagcatccggcccgaggggacgcgggcgagcagcgtggagatcttcctg
gtggggctgaagcggaaggcggcggggaagacggggtag

DBGET integrated database retrieval system