KEGG   Sorangium cellulosum So ce56: sce2464Help
Entry
sce2464           CDS       T00634                                 

Gene name
hisD
Definition
(GenBank) Family membership
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00340  Histidine metabolism
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    sce2464 (hisD)
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     sce2464 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh CobN-Mg_chel
Motif
Other DBs
NCBI-ProteinID: CAN92623
UniProt: A9G5W4
Position
complement(3321188..3322570)
Genome map
AA seq 460 aa AA seqDB search
MLPIYIEGSPQFESTLSALRTRGTGDLANVTPAVTEIIDNVRRGGTSAVLGYIEKFERRT
SKALVRHAGPEAEGGFGGAEALARLSPEVRAALETAAARIARYHERQRDAGDLGPANVTA
NGPALQAGFSYEEEGVLLGMRVRPLRRVGVYAPGGKARYPSSVLMSAIPARIAGVREIVL
ASPSADDATLAAAHLSGVTTLLDSGGAQAIAAMAYGLPELAPVDKIVGPGNAYVACAKKL
VFGDVSIDGITGPSEILALADESADPRLVAADLLSQAEHDEASYALLATTSAKLAEAVAR
ELDAALPELTRRAIVQASLSTHAAALVVGSRARLAEIADQLAVEHVAFHVADAEGLFSEI
GTLGAALLGDLTPVAAGDYLAGPSHVLPTGGSARFGAPLGVYDFVTRASLIRYSSAALRA
QGPIIEKLALAEGLQAHARAVSLRLASKATDPAKRGASQS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccatctacatcgaaggttcgcctcagttcgagtccaccctgtcagccctgcgc
acccgcggcacgggcgacctcgcgaacgtcacgccggccgtgaccgagatcatcgacaac
gtgcggcgcggggggacgtccgccgtgctcggctacatcgagaagttcgagcggaggacg
tcgaaggcgctcgtccgccacgcaggccccgaggcggagggcggcttcggcggagccgag
gcgctcgcgaggctctcgccggaggtccgcgccgcgctcgagaccgcggcagcgaggatc
gcgcgttaccatgagcggcagcgcgacgcgggcgatctcggccccgcgaacgtgacggcg
aacgggcccgcgctgcaggccggtttcagctacgaggaggagggcgtcctgctgggcatg
cgcgtgcgcccgctgcgccgggtcggcgtctacgcgccgggcggcaaggcccgctacccc
tccagcgtgctcatgtcggccatccccgcgcgcatcgccggcgtgcgggagatcgtcctc
gcgagcccgtcggccgacgacgccacgctcgccgcggcgcacctctccggcgtgacgacc
ctgctcgactcgggcggcgcgcaggcgatcgcggccatggcctacgggctcccggagctc
gcgccggtcgacaagatcgtggggcccggcaacgcgtacgtcgcctgcgcgaagaagctg
gtcttcggggacgtgtcgatcgacggcatcaccgggccgagcgagatcctcgcgctcgcc
gacgaatccgcggatccccggctcgtcgccgccgatctgctctcgcaggccgagcatgac
gaggcgtcctacgccctgctcgcgacgacctccgcgaagctggcggaggcggtcgcccgc
gagctcgacgcggcgctccccgagctcacgcggcgcgcgatcgtgcaggcgtcgctctcg
acgcacgcggcggcgctggtcgtcggctcgcgcgctcgcctcgccgagatcgccgatcag
ctcgcggtcgagcacgtggccttccacgtcgccgacgccgaggggttgttctcggagatc
ggcacgctcggcgccgcgttgctcggcgacctcaccccggtcgccgcgggcgactacctc
gcggggccgtcccacgtcctcccgaccggcggctcagcccgcttcggcgcgccgctcggg
gtctacgacttcgtgacgcgcgcgagcctcatccggtactcgagcgcggcgctccgggcg
caaggcccgatcatcgagaagctggccctggccgagggcctgcaggcgcacgcccgcgcc
gtgtcgctccgcctcgcgagcaaggcgaccgaccccgcgaagcgcggcgcgtcgcagtcc
tga

DBGET integrated database retrieval system