KEGG   Sorangium cellulosum So ce56: sce3713Help
Entry
sce3713           CDS       T00634                                 

Gene name
folD1
Definition
(GenBank) Methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00670  One carbon pool by folate
scl01100  Metabolic pathways
scl01120  Microbial metabolism in diverse environments
scl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    sce3713 (folD1)
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     sce3713 (folD1)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     sce3713 (folD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH ATPgrasp_N
Motif
Other DBs
NCBI-ProteinID: CAN93873
UniProt: A9GW22
Position
5187214..5188077
Genome map
AA seq 287 aa AA seqDB search
MAAKILDGKAIAQKVRDEVREGVARFVAAHGRPPGLEVVLVGEDPASVTHTRSKERMSNE
VGIRGRLRALPAATTEAELLACVAELDADDTVDGILVQLPLPARIRAHAVLDAIDPAKDV
DGLHPVNAGLLAMGRPGGIAPCTPVGCMRLLAEAGVELAGARAVVVGRSNLVGRPMAQLL
LARHATVAIAHTRTRDLKALCREADVLVVAAGKAKLIGGDWIKEGATVIDVGMNRDDAGK
LVGDVDFDAVRERAAWITPVPGGVGPMTIASLLETTLRAAEARVAKR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaagatcctggacggcaaggcgatcgcgcagaaggtccgcgacgaggtgcgg
gagggggtggcgcgcttcgtggccgcccacggtcggccccccggcctcgaggtggtgctc
gtcggtgaggacccggccagcgtgacgcacacgcggagcaaggagcggatgtcgaacgag
gtcggcattcgaggacggctccgcgcgctcccggccgcgacgaccgaggccgagctgctc
gcgtgcgtcgcggagctcgacgcggacgacaccgtcgacgggatcctcgtccagctgccg
ctgccggcgcgcatccgcgcgcacgccgtgctcgacgccatcgatcccgcgaaggacgtc
gacggcctccacccggtgaacgcagggctgctcgcgatgggccgcccgggcggcatcgcg
ccgtgcacgccggtcggctgcatgcgcctgctcgccgaggcgggcgtcgagctcgccggc
gcccgcgcggtggtggtggggcggagcaacctcgtcggcaggccgatggcgcagctgctg
ctcgcgcggcacgcgacggtcgcgatcgcccacacgcgcacgcgcgatctgaaggcgctc
tgccgcgaggccgacgtcctcgtggtggcagcgggcaaggcgaagctcatcggcggcgac
tggatcaaggaaggggccacggtgatcgacgtcggcatgaaccgcgacgacgcgggcaag
ctggtgggcgacgtcgatttcgacgccgtcagggagcgggccgcctggatcacgccggtg
cccggcggcgtcggccccatgacgatcgcctcgctgctcgagacgacgctgcgcgccgcg
gaagcgcgcgtcgcgaagcggtag

DBGET integrated database retrieval system