KEGG   Sorangium cellulosum So ce56: sce3802Help
Entry
sce3802           CDS       T00634                                 

Gene name
aceF1
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00010  Glycolysis / Gluconeogenesis
scl00020  Citrate cycle (TCA cycle)
scl00620  Pyruvate metabolism
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01120  Microbial metabolism in diverse environments
scl01130  Biosynthesis of antibiotics
scl01200  Carbon metabolism
Module
scl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce3802 (aceF1)
   00020 Citrate cycle (TCA cycle)
    sce3802 (aceF1)
   00620 Pyruvate metabolism
    sce3802 (aceF1)
Enzymes [BR:scl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     sce3802 (aceF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: CAN93962
UniProt: A9GWQ7
Position
5295261..5296577
Genome map
AA seq 438 aa AA seqDB search
MAKVLELPKLSPTMEEGQISAWHKKEGDAIDIDDLLAEVETDKATMEYKSFDRGTLLKIL
VPAGSVVQLGQPVAIIGTPGEDVSALAGGSGGAAAAKPSAAEAQPKGERAAPPAGGDAPV
TSPPPAARGEAVSPPTQPAAPQPSSNGRVKASPYVRKLGRERGLDLSSVAGSGPRGRIVA
RDLEGLKPAPAAAAKATAPGELAAPEVRPLSMMRKAIARRLTESKQTVPHFYLSIDVDAD
PLNALREQINADLAATAAEGEKPAKVSFNDLLVKACAIALVRVPECNAQFTPDAILVHQR
VDISVAVAVPEGLVTPVVRDVDRKQVLDIAAEVRELAGRAKAKKLRPEEMANGTFSISNL
GMYGIDNFGAVINPPEGAILAVGQVRREPVVRGEQIVPGRRLSMTLSCDHRVVDGAVGAT
FLKVLRQLLEHPTQILIG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggttctggaacttccgaagctgtccccgaccatggaggaggggcagatcagt
gcctggcacaagaaggaaggcgacgcgatcgacatcgacgatctgctcgcagaggtcgag
accgacaaggcgaccatggagtacaagtccttcgatcgagggacgttgctcaagatcctc
gtgcctgcgggcagcgtggttcagctcggccagcctgtcgcgatcatcggcaccccgggc
gaggacgtaagcgccctcgccggcgggagcggcggcgccgccgcggcgaagccgagcgcg
gcggaggctcagcccaagggagagcgcgccgcgccgccggccggcggcgacgcgcccgtg
acgagcccgccgcccgcggcgcgcggcgaggcggtctcgccgcccacgcagccggccgcg
ccgcagccgtcgtcgaacggacgcgtgaaggcgtcgccttacgtgcggaagctcggccgg
gagcgcgggctcgacctcagcagcgtcgccggcagcggtccgcgcgggcgcatcgtcgcg
cgcgacctcgaggggctgaagccggcgccggccgccgcggccaaggcgaccgcccccggc
gagctcgctgcgccggaggtgcggccgctcagcatgatgcgcaaggcgatcgcccggcgc
ctcaccgagtccaagcaaacggtcccgcacttctacctctcgatcgacgtcgacgccgat
ccgctgaacgcgcttcgcgagcagatcaacgcggatctcgcggcgaccgccgccgagggg
gagaagccggccaaggtcagcttcaacgatctcctcgtcaaggcgtgcgccatcgcgctc
gtgcgcgtcccggagtgcaacgcgcagttcaccccggacgccatcctcgttcaccagcgc
gtcgacatctcggtcgcggtcgccgtccccgagggcctcgtcacgccggtggtgcgcgac
gtcgatcgcaagcaggtgctcgacatcgcggccgaggtgcgcgagctcgccgggcgagcc
aaggcgaagaagctgcggcccgaggagatggcgaacggcacgttctcgatctcgaacctc
ggcatgtacgggatcgacaacttcggcgccgtcatcaacccgcccgagggagcgatcctc
gccgtgggccaggtccgtcgcgagcccgtcgtgcgcggcgagcagatcgttccgggccgc
cggctgagcatgacgctctcctgcgatcatcgcgtcgtcgacggcgcggtcggcgcgacc
ttcctcaaggtcctgcgccagctcctggagcacccgacgcagatcctgatcggctag

DBGET integrated database retrieval system