KEGG   Sorangium cellulosum So ce56: sce4981
Entry
sce4981           CDS       T00634                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
scl  Sorangium cellulosum So ce56
Brite
KEGG Orthology (KO) [BR:scl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:scl02044]
    sce4981
Secretion system [BR:scl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   sce4981
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: CAN95144
UniProt: A9FKS3
Position
complement(6996626..6998110)
AA seq 494 aa
MATETQAAGSAGVQTLEGGSLLDEILAETKMTPGDEGYEIAKRGVQAFISELVAPRREGE
KVDKAFVDALIAEIDVKLSRQIDEILHNPSFQKLESAWRGLKFVIDRCDFRENVKVEMLN
CSKEDLLADFEDAPEVPKSGLYKIVYSAEFGQFGGKPVGAIIANYEFGPGPQDIALLQKC
AAVATMSHAPFIAAAGPQFFGLKDFQGLPNLKDLKALFEGPQYTKWNAFRETEDARYVGL
VMPRFLLRLPFGANTVPVKAFNYEEDVVGKHDAYCWGNATYAFATRLADSFAKYRWCPNI
IGPQAGGSVENLPLHQYEAMGEIQTKVPTEIMLTERREFELSEEGFIGLTFRKDSDNACF
FSANSAQKAKFFGQSDEGRAAEMNYRLGTQLPYMFIMCRIAHYLKVLQREQIGTWKERAD
LEKELNDWIGQYVADQDVVSAATRGRRPLRKARIIVTEVPGNAGWYKVDMQVRPHFKYMG
AFFTLSLVGKLDKE
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggcgacggagacacaggccgcggggagcgcgggcgtccagaccctcgagggggggtcg
ctgctcgacgagatcctcgccgagacgaagatgacgcccggcgacgaggggtacgagatc
gccaagcggggcgtgcaggccttcatctcggagctcgtcgccccgcggcgcgagggcgag
aaggtcgacaaggccttcgtcgacgcgctgatcgcggagatcgacgtcaagctgtcgcgg
cagatcgacgagatcctccacaacccgagcttccagaagctcgagtccgcgtggcgcggc
ctcaagttcgtcatcgaccggtgtgacttccgcgagaacgtcaaggtcgagatgctcaac
tgctccaaggaggacctcctcgccgatttcgaggacgcccccgaggtgccgaagagcggc
ctctacaagatcgtctactcggccgagttcgggcagttcggcggcaagccggtcggcgcg
atcatcgcgaactacgagttcggcccgggcccccaggacatcgcgctcctccagaagtgc
gccgcggtcgcgacgatgtcgcacgcgcccttcatcgcggcggccgggccgcagttcttc
ggcctgaaggacttccaggggctgcccaacctgaaggacctcaaggcgctcttcgagggg
ccgcagtacacgaagtggaacgcgttccgcgagaccgaggacgcgcgctacgtcgggctc
gtgatgccgcgcttcctgctccgcctgcccttcggcgccaacaccgtcccggtgaaggcg
ttcaactacgaggaggacgtggtcggcaagcacgacgcgtactgctggggcaacgcgacg
tacgcgttcgccacccggctcgccgacagcttcgccaagtaccgctggtgtccgaacatc
atcggcccccaggcgggcggctccgtggagaacctgccgctccaccagtacgaggcgatg
ggcgagatccagacgaaggtgccgaccgagatcatgctcaccgagcggcgcgagttcgag
ctctccgaggagggcttcatcgggctcacgttccgcaaggactcggacaacgcctgcttc
ttctcggccaactccgcccagaaggcgaagttcttcgggcagagcgacgagggcagggcg
gccgagatgaactaccggctcggcacgcagctgccgtacatgttcatcatgtgccgcatc
gcgcactacctgaaggtgctgcagcgcgagcagatcggtacgtggaaggagcgcgccgat
ctcgagaaggagctcaacgactggatcggccagtacgtcgccgatcaggacgtcgtctcc
gcggcgacccgcgggcgcaggccgctccgcaaggcgcgcatcatcgtgaccgaggtgccg
gggaacgccggctggtacaaggtcgacatgcaggtgcgcccgcacttcaagtacatgggc
gccttcttcacgctgagcctcgtcggcaagctcgacaaggagtga

DBGET integrated database retrieval system