KEGG   Sorangium cellulosum So ce56: sce4995
Entry
sce4995           CDS       T00634                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:scl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    sce4995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:scl02044]
    sce4995
Secretion system [BR:scl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   sce4995
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CAN95158
UniProt: A9FKX5
Position
7018446..7018931
AA seq 161 aa
MPLSAYLRLVGERQGEIRGSVTQKGREGSILVTEVFHSLVGPRDPVTGRPTGKRMHKPFI
VTKDLDRSTPLLLSILSHNESIPRWELQFYRSIAIGVERPVFTVQLTNANISSIQFHMLN
VRNPGQSRLPEQEEVAFTYQKVVWTWNDGGLSAEDDWLTPR
NT seq 486 nt   +upstreamnt  +downstreamnt
atgcccctcagcgcctacctcagactcgtcggcgaaagacaaggggaaatcaggggctcc
gtcacccagaaggggcgagaaggtagcatcctcgtcaccgaggtgttccactcgctggtg
gggccgcgcgacccggtcaccgggcgcccgacgggcaagcggatgcacaagcccttcatc
gtcacgaaggacctcgatcggtccacgccgctcctcctcagcatcctcagccacaacgag
agcatcccccgctgggagctccagttctacaggtcgatcgcgatcggcgtcgagaggcct
gtcttcacggtccagctcacgaacgcgaacatctcgagcatccagttccacatgctcaac
gtgaggaacccggggcaatcgcgcctgcccgagcaggaggaggtcgcgttcacgtaccag
aaggtcgtctggacctggaacgacgggggcctctccgcggaagacgactggctcaccccg
cgctga

DBGET integrated database retrieval system