KEGG   Sorangium cellulosum So ce56: sce4997
Entry
sce4997           CDS       T00634                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
scl  Sorangium cellulosum So ce56
Brite
KEGG Orthology (KO) [BR:scl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:scl02044]
    sce4997
Secretion system [BR:scl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   sce4997
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: CAN95160
UniProt: A9FKY1
Position
7019471..7021240
AA seq 589 aa
MFNKYYQDELTYLRDLGREFAAAYPGIAPMLAEKGGDPDVERLLEGVAFLTGKIRQKLDD
ELPEVIHSVASLLFPHYLRQIPATSIIEFTPLPNVVREKLVVARHAEVGSVPVDGVSCRF
RTTQDVELVPLAVEDVRVDTGAQLAQTLRIELRLTGGAALSGLSLSSLRFYIHGERRLQD
DLRLWVGAHVDTVALAAVDAAGRDTTIASLPARAVRLTGFSDEESLIPYPKTVYPGFRLL
QEFFTLPQKFAFFEVTGLQALSAERISDRFAILLQFKDGLPPGTRIGKENIRLFCSPVVN
LFEHTSDPIKPEATKHEYLCRPAGAAPAAFEIHSIDKVVGIARRTSQRVEIPSFFSFQHE
LDPEAAARTIFYQAHLRPAAIGDGIDMYLSFGSPQDAGALPEFDVISIEATSTNRRLPAQ
LKLGDLRVPTATSPAVASFTNLTGVTAPLPPPLGRELQWRVLAHMAMSYRSITELEVLRA
TVDLYNFQAIVDRQAARANQLRLAAIKAIRVRPTDRLYRGAPVRGVAVDIELDEGGFVGE
GEMYLFASILNEMLGSYVSLNSFTQLTVTGTNTRVVHKWDPKSGSLTLI
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgttcaacaagtactaccaggacgagctcacctacctgagggatctggggcgcgagttc
gccgccgcctaccccgggatcgcccccatgctcgcggagaaaggcggggaccccgacgtc
gagcgcctgctcgagggcgtcgcgttcctgaccggcaagatccgccagaagctcgacgac
gagctccccgaggtgatccactcggtcgcgtcgctgctctttccgcactacctccgccag
atcccggcgacctcgatcatcgagttcacgccgctcccgaacgtcgtgcgcgagaagctc
gtcgtcgctcggcacgcggaggtcgggtcggtgccggtcgacggcgtctcgtgccggttc
cgcacgacccaggacgtcgagctcgtcccgctcgcggtggaggacgtgcgcgtcgacacg
ggcgcgcagctcgcgcagacgctccgcatcgagctccgcctgaccggcggcgccgcgctg
tcgggcctgtcgctctcctcgctgcgcttctacatccacggcgagcgcaggctgcaggac
gacctccgcctctgggtcggggcgcacgtcgacaccgtcgcgctcgccgcggtggacgcc
gcggggcgcgacacgacgatcgcgtcgctcccggcgcgcgccgtgcggctcaccggcttc
tccgatgaagagtcgctgatcccgtacccgaagacggtctatccgggcttccggctcctg
caggagttcttcacgctcccgcagaagttcgcgttcttcgaggtgaccggcctccaggcg
ctctcggcggagcggatctccgaccggttcgcgatcctgctgcagttcaaggacgggctc
ccgccggggacgcggatcggcaaggagaacatccgcctgttctgctcgccggtcgtgaac
ctgttcgagcacacgagcgatccgatcaagcccgaggccacgaagcacgagtacctctgc
cgcccggcgggcgcggcgcccgcggccttcgagatccacagcatcgacaaggtcgtcggc
atcgcccggcgcacgagccagcgcgtcgagatcccctcgttcttcagcttccagcacgag
ctcgatcccgaggccgccgcgcggacgatcttctaccaggcgcacctccgcccggccgcc
atcggcgacggcatcgacatgtacctctcgttcggctccccgcaggacgcgggggccctc
cccgagttcgacgtgatcagcatcgaggcgacgagcacgaaccgccgcctgccggcgcag
ctcaagctcggcgatctcagggtgccgacggcgacctcacccgccgtggcgagcttcacc
aacctcaccggcgtcaccgcgccgctcccgccgccgctcgggcgcgagctgcagtggcgc
gtcttggcccacatggcgatgagctaccgctcgatcaccgagctcgaggtgctccgggcg
acggtcgatctctacaatttccaggcgatcgtcgatcgtcaggcggcgcgcgcgaaccag
ctccgcctggccgcgatcaaggcgatccgggtgcggccgacggatcggctgtaccgaggg
gcgccggtgcgcggcgtcgcggtcgacatcgagctcgacgagggcgggttcgtcggcgag
ggcgagatgtacctgttcgcgagcatcctgaacgagatgctcgggtcctacgtctcgctg
aactcgttcacgcagctgacggtcaccggcacgaatacacgcgtggtgcacaaatgggac
ccgaagagcggcagcctgacgctgatctga

DBGET integrated database retrieval system