KEGG   Sorangium cellulosum So ce56: sce5931Help
Entry
sce5931           CDS       T00634                                 

Gene name
rluD3
Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
scl  Sorangium cellulosum So ce56
Brite
KEGG Orthology (KO) [BR:scl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:scl03009]
    sce5931 (rluD3)
Enzymes [BR:scl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     sce5931 (rluD3)
Ribosome biogenesis [BR:scl03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    sce5931 (rluD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 CT_C_D
Motif
Other DBs
NCBI-ProteinID: CAN96095
UniProt: A9GBV3
Position
8329156..8330193
Genome map
AA seq 345 aa AA seqDB search
MAAGAGALHFRFRVDDGDPRDRLDKLVVHLLERAGHAASRAAVQRWIAAGRVLVDGEPAR
ASVAVRASALVEVRPEEPSPSPTAAEPDVVIPVVYEDEHLLVIDKPAGLVVHPARGHASG
TLVNGLLALPGFALAPADPRDPMGHVRPGIVHRLDRGTSGLLVVAKDEPTREALKDRFAR
HAIEREYAAIVAGEARDATYDTLHGRHPTDRLRFTSWIRGGAGAPGSHVAAPRRAVTHVR
VIERLGDAATVVACSLETGRTHQIRVHLAERGRTPVLGDPLYGKPPKKPAVRAIAEELGR
QALHARVLGFIHPATQKPVRWESALPADMRKALDQLRALATRSSI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggctgccggtgcaggagcgctccacttccgtttccgggtggacgacggcgaccctcgt
gaccggctcgacaagctcgtcgtccacctgctcgagcgcgccggccatgcggcctcccgc
gcggcggtgcagcggtggatcgccgccggtcgggtcctcgtcgacggggagcccgcgcgc
gcgtcggtggcggtgcgcgcaagcgcgctggtcgaggtccgccccgaagagccgtcgccc
tcgcccaccgcggccgagcccgacgtggtcatcccggtggtgtacgaggatgagcacctg
ctcgtcatcgacaaacctgccgggctcgtcgtgcatccggcccgcggccacgcgtccggc
acgctggtcaacgggctgctcgccctgcccgggttcgccctggcgcccgccgatccgcgc
gatcccatgggccatgtccgcccggggatcgtgcacaggctcgaccgagggacgagcggc
ctgctcgtcgtggcgaaggacgagcccacccgcgaggcgctgaaagatcggttcgccagg
cacgcgatcgagcgcgagtacgccgcgatcgtcgccggcgaggcgcgagacgccacctac
gacacgctccacggccggcacccgaccgacaggctccggttcacgtcgtggatccgcggc
ggcgccggcgcgcccggatcacacgtcgccgcgccgcgccgcgccgtgacgcacgtccgc
gtgatcgagcggctcggcgacgcggcgaccgtcgtcgcgtgctcgctcgagacgggccgc
acccaccagatccgggtgcacctcgccgagcgcggcaggacacccgtcctcggagacccc
ctctacggcaagccgccgaagaagccggcggtacgggcgatcgcggaggagctgggccgg
caagccctccacgcgcgcgtgctcgggttcatccaccccgccacgcaaaagcccgtccgc
tgggagagcgcgctgccagcggacatgcgcaaggcgctcgaccagctgcgggcgctcgct
accagatcttcgatttga

DBGET integrated database retrieval system