KEGG   Sorangium cellulosum So ce56: sce7105Help
Entry
sce7105           CDS       T00634                                 

Gene name
pcaF
Definition
(GenBank) Putative beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00071  Fatty acid degradation
scl00072  Synthesis and degradation of ketone bodies
scl00280  Valine, leucine and isoleucine degradation
scl00310  Lysine degradation
scl00362  Benzoate degradation
scl00380  Tryptophan metabolism
scl00620  Pyruvate metabolism
scl00630  Glyoxylate and dicarboxylate metabolism
scl00640  Propanoate metabolism
scl00650  Butanoate metabolism
scl00900  Terpenoid backbone biosynthesis
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01120  Microbial metabolism in diverse environments
scl01130  Biosynthesis of antibiotics
scl01200  Carbon metabolism
scl01212  Fatty acid metabolism
scl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:scl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    sce7105 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    sce7105 (pcaF)
   00640 Propanoate metabolism
    sce7105 (pcaF)
   00650 Butanoate metabolism
    sce7105 (pcaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    sce7105 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    sce7105 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    sce7105 (pcaF)
   00310 Lysine degradation
    sce7105 (pcaF)
   00380 Tryptophan metabolism
    sce7105 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    sce7105 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    sce7105 (pcaF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    sce7105 (pcaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scl04147]
    sce7105 (pcaF)
Enzymes [BR:scl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     sce7105 (pcaF)
Exosome [BR:scl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   sce7105 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAN97274
UniProt: A9ER99
Position
9904196..9905380
Genome map
AA seq 394 aa AA seqDB search
MTLPVPVYIVAAARTPIGAFQGALSPLPAPRLGEVAIRAALERAKLSPEAVEEVFLGNVL
SAGIGQAPARQAAIFAGIPSKVPATTVSKVCGSGLQAVIFGAKTVALGDADVVVAGGMES
MSNVPYYLPQARSGYRMGDGKLVDGMIHDGLWDPYGNFHMGTAGDACAREHGFSREAQDE
YAKESFRRAVAAQREGLFAAEIAPVSVPQKKGDAVIVKDDEGPPAGKPEKFASLKPAFQK
DGTITAANASSINDGASALVLASERAVKEHKLTPLARIVGYGGAAQAPEWFTTAPAAAIA
NTTKKLGIPTDQIDLFEVNEAFAVVALAVNKLSGLDAQKVNVRGGAVALGHPIGASGARI
LTTLLFAMKDRNAKRGLATLCIGGGEALAVVVER
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcccgtccccgtgtacatcgtcgcagcggcccggacgccgatcggcgcgttc
cagggcgcactctcgcccttgcccgccccccgcctgggtgaggtcgccatccgggcggcg
ctcgagcgggcaaagctgtctccggaggccgtcgaggaggtgttcctcggcaatgtcctg
tccgccggtatcgggcaggctccggcccggcaggccgccatcttcgccggcatcccgagc
aaggtgccggccaccaccgtgagcaaggtctgcggctcgggcctccaggccgtcatcttc
ggcgcgaagacggtggcgctcggcgacgcggacgtcgtcgtcgccggcggcatggagtcg
atgtcgaacgtgccctactacctcccgcaggcgcgctccggctaccgcatgggcgacggc
aagctcgtggacggcatgatccacgatggcctgtgggatccgtacggcaactttcacatg
ggcaccgcgggcgacgcgtgcgccagggagcacggcttctcgcgggaggcgcaggacgag
tacgcgaaggagagcttccgccgcgcggtcgcggcccagcgcgaggggctcttcgccgcg
gagatcgcgcccgtctccgtcccgcagaagaagggcgacgccgtgatcgtgaaggacgac
gagggcccgcctgccggcaagcccgagaagttcgcgtccctgaagcccgcgttccagaag
gacgggacgatcaccgcggccaacgcgtcgtcgatcaacgacggcgccagcgcgctcgtg
ctggcgagcgagcgggccgtcaaggagcacaagctcacgccgctcgcgcggatcgtcggc
tatggcggcgccgcgcaggcgcccgagtggttcacgacggcgccggccgcggccatcgcg
aacaccacgaagaagctcggcatcccgacggaccagatcgacctcttcgaggtgaacgag
gcgttcgcggtggtggcgctcgcggtgaacaagctctccgggctcgacgcccagaaggtc
aacgtccgcggcggcgcggtcgcgctcggccacccgatcggcgcgagcggggcgcgcatc
ctgacgacgctgctcttcgccatgaaggaccggaacgcgaagcgcggcctggccacgctc
tgcatcggcggcggcgaggcgctcgcggtcgtcgtggagcggtga

DBGET integrated database retrieval system