KEGG   Sorangium cellulosum So ce56: sce7348Help
Entry
sce7348           CDS       T00634                                 

Gene name
tpi
Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00010  Glycolysis / Gluconeogenesis
scl00051  Fructose and mannose metabolism
scl00562  Inositol phosphate metabolism
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01120  Microbial metabolism in diverse environments
scl01130  Biosynthesis of antibiotics
scl01200  Carbon metabolism
scl01230  Biosynthesis of amino acids
Module
scl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
scl_M00002  Glycolysis, core module involving three-carbon compounds
scl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sce7348 (tpi)
   00051 Fructose and mannose metabolism
    sce7348 (tpi)
   00562 Inositol phosphate metabolism
    sce7348 (tpi)
Enzymes [BR:scl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     sce7348 (tpi)
Exosome [BR:scl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   sce7348 (tpi)
  Exosomal proteins of bladder cancer cells
   sce7348 (tpi)
  Exosomal proteins of melanoma cells
   sce7348 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAN97517
UniProt: A9EY71
Position
complement(10238826..10239659)
Genome map
AA seq 277 aa AA seqDB search
MNDGGTSAEAGAAPRAASRRPLIAGNWKMNAGGQDACPLSAAVAKATRELTRAEVVVAPP
FTAIAAVAHELAEAKSEVGIAAQNMSAEVSGAFTGEVSSGMLKDAGATWVILGHSERRQL
FAETDESVARKVASAMAAELRPIVCVGETLEQREAGETLAVVERQVRAVLDELAKQPGFG
VIAYEPVWAIGTGKVARAEDAQEVHAFIRGLLAKASEDLAGVTRILYGGSVKADNAEALL
AQDDIDGALVGGASLDAAGFAKIVDAAHRLAERAEQG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgatgggggcacgtccgcggaggcgggcgccgccccgcgggcggcctcgcgtcgt
ccgctcatcgccggcaactggaagatgaacgccgggggccaggacgcatgtcctctctcg
gcggccgtcgccaaggcgacgcgcgagctcacccgggccgaggtggtggtcgctccgccg
ttcacggcgatcgccgccgtggcccacgagctcgcggaggcgaagagcgaggtcggcatc
gccgcgcagaacatgagcgccgaggtctccggggcgttcaccggcgaggtctcctcgggc
atgctcaaggacgcgggcgcgacctgggtgatcctcgggcacagcgagcggcggcagctg
ttcgccgagaccgacgagtcggtcgcccggaaggtcgcctcggcgatggccgccgagctg
cgccccatcgtctgcgtcggcgagacgctcgagcagcgcgaggcgggtgagacgctcgcc
gtggtcgagcggcaggtccgcgccgtcctcgacgagctcgcgaagcagcccggcttcggc
gtcatcgcctacgagccggtctgggccatcgggacgggcaaggtcgcgcgcgccgaggac
gcccaggaggtgcacgcgttcatccgcggcctgctcgcgaaggcctcggaggacctcgcg
ggcgtcacgcgcatcctctacggcggcagcgtcaaggccgacaacgccgaggcgctgctc
gcccaggacgatatcgacggcgcgctggtcggcggggcttcgctcgacgccgctggcttc
gccaagatcgtcgacgccgctcaccgactggcggagcgcgcggaacaggggtag

DBGET integrated database retrieval system