KEGG   Sorangium cellulosum So ce56: sce7652Help
Entry
sce7652           CDS       T00634                                 

Definition
(GenBank) Acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00071  Fatty acid degradation
scl00072  Synthesis and degradation of ketone bodies
scl00280  Valine, leucine and isoleucine degradation
scl00310  Lysine degradation
scl00362  Benzoate degradation
scl00380  Tryptophan metabolism
scl00620  Pyruvate metabolism
scl00630  Glyoxylate and dicarboxylate metabolism
scl00640  Propanoate metabolism
scl00650  Butanoate metabolism
scl00900  Terpenoid backbone biosynthesis
scl01100  Metabolic pathways
scl01110  Biosynthesis of secondary metabolites
scl01120  Microbial metabolism in diverse environments
scl01130  Biosynthesis of antibiotics
scl01200  Carbon metabolism
scl01212  Fatty acid metabolism
scl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:scl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    sce7652
   00630 Glyoxylate and dicarboxylate metabolism
    sce7652
   00640 Propanoate metabolism
    sce7652
   00650 Butanoate metabolism
    sce7652
  09103 Lipid metabolism
   00071 Fatty acid degradation
    sce7652
   00072 Synthesis and degradation of ketone bodies
    sce7652
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    sce7652
   00310 Lysine degradation
    sce7652
   00380 Tryptophan metabolism
    sce7652
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    sce7652
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    sce7652
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    sce7652
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:scl04147]
    sce7652
Enzymes [BR:scl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     sce7652
Exosome [BR:scl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   sce7652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAN97821
UniProt: A9F5N2
Position
complement(10649269..10650501)
Genome map
AA seq 410 aa AA seqDB search
MRDVFIVDAVRTPRGRGKAGKGALSGVHPQELLAQTLNRLAEKTGIRKQDVEDVVVGCVT
QAGEQGACIARTAILAAGWPDVVTGVTVNRFCGSGAQAVNFAAMGVMSGQQEVAIGGGVE
SMSRVPMGSDGAPLDGNNLALRKKLAMVPQGISADLIATIEGFSREDVDRFALESQRKAE
RAAGEGRFAKSLFTVVDLDGKPLLDRDEHPRAGATMEALAKLEPAFGSLGSTPMGPAGET
VDALALARYPQVASIRHVHTAGNSSGIVDGAAVVLLASGDYVKAHGLAPRARIRATATVG
AEPVIMLTAPAPASERALKKAGMQARDVDLWEINEAFAAVPLQTARKLDIDLDRVNVNGG
AIALGHPLGATGACLIGTALDELERAGKATALITLCIGGGMGVATILERV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcgagacgtcttcatcgtggatgccgttcgcacgccgcgcgggcgcggcaaggcgggc
aagggagcgctctcgggcgtgcaccctcaagagctcctcgcgcaaacgctcaatcgcctc
gccgagaagaccgggatccgcaagcaggacgtcgaggatgtggtcgtcgggtgcgtgacc
caggcgggcgagcagggcgcgtgcatcgcgcgcaccgccatcctcgcggccggctggccg
gacgtcgtgaccggcgtgaccgtcaaccgcttctgcggctcgggcgcgcaggcggtgaac
ttcgcggcgatgggggtcatgtccggccagcaggaggtcgccatcggcggcggcgtcgag
agcatgtcgcgcgtgccgatgggctcggacggcgcgcccctcgacgggaacaacctcgcc
ctccgcaagaagctcgcgatggtcccgcagggcatctcggcggacctcatcgccacgatc
gagggcttctcgcgcgaggacgtcgaccgcttcgcgctggagagccagcgcaaggccgag
cgggccgcgggcgaggggcgcttcgcgaagagcctcttcacggtcgtcgatctcgacggc
aagccgctgctcgacagggacgagcacccgcgggccggggcgacgatggaggccctcgcg
aagctcgagcccgcgttcggaagcctcgggtcgacgccgatgggccccgcaggtgagacc
gtggatgcgctggcgctggcgcgctatccgcaggtggcgtcgatccggcacgtccacacg
gcgggcaactcgagcggcatcgtggacggggcggccgtcgtgctgctcgcgtccggcgac
tacgtgaaggcgcacgggctcgccccgcgcgcgaggatccgcgccacggcgacggtcggc
gccgagccggtgatcatgctgacggcccccgcgcccgcgtcggagcgcgccctcaagaag
gcgggcatgcaggcgcgcgacgtcgatctctgggagatcaacgaggcgttcgcggcggtg
ccgctgcagacggcgcgcaagctcgacatcgacctcgaccgcgtcaacgtgaacggcggc
gcgatcgcgctcgggcacccgctcggcgcgaccggggcctgcctgatcgggacggcgctc
gacgagctcgagcgcgccggcaaggcgaccgcgctgatcacgctgtgcatcggcggaggg
atgggcgtggcgaccatcctcgagcgggtgtga

DBGET integrated database retrieval system