KEGG   Sorangium cellulosum So ce56: sce8077Help
Entry
sce8077           CDS       T00634                                 

Gene name
cbhA
Definition
(GenBank) Cellulose 1,4-beta-cellobiosidase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00500  Starch and sucrose metabolism
scl01100  Metabolic pathways
scl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:scl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    sce8077 (cbhA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    sce8077 (cbhA)
Enzymes [BR:scl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     sce8077 (cbhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-ProteinID: CAN98247
UniProt: A9FHT2
Position
complement(11235644..11237074)
Genome map
AA seq 476 aa AA seqDB search
MLRRNAHQLGLATSVAVILALAACGDGGGGDTSGTGGGSSGVGAGNPTSSGVGAGTPTSS
GNVDPTTTSSGNVDPTTTSSGNVDPTTTSSGNVDPTTSAASGGGNCSPAVDITAPSGNPF
ADAHLFVDPGYVKKVDSSIAQVTDTALKAKMEKVKQIQTAFWLDRIEAIKELPAYLDAAL
KLQNELCEPVTALIVVYDLPNRDCFAEASNGELHLDQNGTQRYREEYIAPIKQILAAHSG
QRIAAVIEPDSLPNIATNLGGKRCDETTAQSYRDNVAHTLKELNMPHVYQYIDAAHSGWL
GWPDNQKKGAKIFAEVIKAAGSPANVRGFATNVANYTQLSYTAESYDQQDNPCFGEFDYV
DAMASALSAEGLGDKHFIIDTSRNGVGNIREDWGYWCNNKGAGMGQRPKANPGGATNLDA
FVWVKPPGDSDGVGQEGQPRYDLFCGKENADTRAPQAGQWFHEYFVECVKNANPAL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaaggaatgcgcatcagctggggttggcaacgtcggttgcggtcatcctcgcg
ctcgcggcgtgcggggacggcgggggcggtgacaccagcgggacgggcgggggcagcagc
ggcgtgggcgcgggcaacccgacgagcagcggcgtgggcgcgggcaccccgacgagcagc
ggcaacgtcgacccgacgacgacgagcagcggcaacgtcgacccgacgacgacgagcagc
ggcaacgtcgacccgacgacgacgagcagcggcaacgtcgacccgacgaccagcgcggct
tcgggcggcggcaactgctcccccgcggtcgacatcacggcgccgagcggcaacccgttc
gcggacgcgcacctgttcgtggaccccggttacgtcaagaaggtcgactcgtcgatcgcg
caggtgaccgatacggccctgaaggcgaagatggagaaggtcaagcagatccagacggcg
ttctggctcgaccggatcgaggcgatcaaggagctcccggcctacctcgacgcggcgctc
aagctccagaacgagctctgcgagccggtcactgcgctcatcgtcgtctacgaccttccg
aaccgcgattgcttcgccgaggcgtcgaacggcgagctccacctcgatcaaaacggcacc
cagcggtaccgggaagagtacatcgccccgatcaagcagatcctcgccgctcactcgggt
cagcgcatcgccgcggtcatcgagcccgactcgctccccaacatcgcgacgaacctgggc
gggaagcgatgcgacgagacgacggcgcagtcctaccgggacaacgtcgcgcacacgctc
aaggagctcaacatgccgcacgtgtaccagtacatcgacgcggcgcactcgggctggctc
gggtggcccgacaaccagaagaagggcgccaagatcttcgccgaggtcatcaaggccgcc
ggcagcccggccaacgtccgcggcttcgcgaccaacgtcgcgaactacacgcagctcagc
tacaccgcggagagctacgatcagcaggacaatccctgcttcggcgagttcgactacgtc
gatgccatggcctcggcgctctcggccgagggcctcggcgacaagcacttcatcatcgac
acgagccgcaacggcgtcggcaacatccgggaggactggggctactggtgcaacaacaag
ggcgcgggcatgggccagcggccgaaggccaacccgggcggcgcgacgaacctcgacgcc
ttcgtgtgggtcaagccgccgggtgactccgacggcgtgggccaggagggtcagccgcgc
tacgacctgttctgcggcaaggagaacgcggacacgcgcgcgccgcaggcggggcagtgg
ttccacgagtacttcgtggagtgcgtgaagaacgccaacccggcgctttga

DBGET integrated database retrieval system