KEGG   Sorangium cellulosum So ce56: sce8333Help
Entry
sce8333           CDS       T00634                                 

Gene name
proB
Definition
(GenBank) Family membership
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00330  Arginine and proline metabolism
scl00332  Carbapenem biosynthesis
scl01100  Metabolic pathways
scl01130  Biosynthesis of antibiotics
scl01230  Biosynthesis of amino acids
Module
scl_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    sce8333 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    sce8333 (proB)
Enzymes [BR:scl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     sce8333 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CAN98503
UniProt: A9FT85
Position
complement(11615917..11617080)
Genome map
AA seq 387 aa AA seqDB search
MTDTEDRTATKGGAAGRAAADAAPELDPQAARAALRRCRRIIVKIGSKSLSGDAWDRLAA
EVAALRGRSGRSLVIVSSGAIALGVAKLGLKSRPKDMAWLQAAAAAGQSVLMQRYEEAFG
KVGLLVAQVLLTHADLADRTRTNNARNALAALLEAGAIPIINENDAVAVEEIKFGDNDQL
AAMVTPLCEADLLILLSDVEGLLDGDGRRVPFVRSVAREARHLAGASTSGVGTGGMASKV
EAARRATLAGSHVVIGAAREAGIITRIVSGEDVGTLFAAVPQRLSARKHWIAYTLRPRGA
ILVDRGAAEAIGSKNRSILAVGVLGVRGTFLPGDAVAVVDPDGTEIARGLARMSASDAAR
TARKKREEAGDDDVVVHRDDLVVLPSE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaccgaggaccgcaccgccacgaagggcggcgccgcgggccgcgccgcggcc
gacgccgcgccggagctcgatccgcaggccgcgcgcgccgcgctccggcgctgccgccgc
atcatcgtcaagatcggctcgaagagcctctccggcgacgcctgggaccggctcgccgcc
gaggtggccgcgctccgcggccgctccggccggagcctcgtcatcgtgtcgagcggcgcc
atcgccctcggcgtggcgaagctcgggctgaagtcgcgcccgaaggacatggcctggctc
caggccgccgccgccgccggccagagcgtgctgatgcagcgctacgaggaggccttcggc
aaggtcggcctgctcgtcgcgcaggtgctgctcacgcacgccgacctcgcggaccgcacg
cgcaccaacaacgcgaggaacgccctggccgcgctgctcgaggcgggcgccatcccgatc
atcaacgagaacgacgccgtcgcggtcgaggagatcaagttcggcgacaacgaccagctc
gcggcgatggtgaccccgctctgcgaggccgatctcctcatcctgctctcggacgtcgag
ggcctgctcgacggcgacgggcgccgggtgccgttcgtgcgcagcgtcgcccgcgaggcg
cggcacctcgcgggcgcgtcgacctccggcgtcggcaccggcggcatggccagcaaggtg
gaggccgcccggcgcgcgacgctcgcgggctcgcacgttgtcatcggcgccgcccgcgag
gcgggcatcatcacgcgcatcgtctcgggcgaggacgtcggcaccctcttcgccgccgtc
ccgcagcggctcagcgcgcgcaagcactggatcgcgtacacgctgcgcccgcgcggcgcc
atcctcgtcgaccggggcgccgccgaggcgatcggctcgaagaaccggagcatcctcgcc
gtcggcgtcctcggcgtgcgcggcaccttcctccccggcgacgccgtggccgtcgtcgac
ccggacggcaccgagatcgcgcgcgggctcgcgcggatgtccgcgagcgacgccgcgcgc
accgcgcggaagaagcgcgaggaggcaggcgatgacgacgtcgtcgtccaccgcgacgac
ctggtggtgctcccgagcgagtag

DBGET integrated database retrieval system