KEGG   Sorangium cellulosum So ce56: sce8412Help
Entry
sce8412           CDS       T00634                                 

Definition
(GenBank) Tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
scl  Sorangium cellulosum So ce56
Pathway
scl00380  Tryptophan metabolism
scl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    sce8412
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     sce8412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: CAN98582
UniProt: A9FU01
Position
11709645..11710883
Genome map
AA seq 412 aa AA seqDB search
MRPVPGPSVFWGAGSRLPAPLVARAHRLLRTRRANPARGASRITKDMNYWDYIHVEELLA
LQGGFDDDEQKVGNDEALFIVVHQIYELWFKLILRELTSARELFRQNPVPDQKLASAARS
FRRVVTIFEQAIEHFRVMETLTTRDYLDFRDRLIPASGFQSAQLREIELLLGLDDALRIP
LGREGSYKEALKTADGAPSAATRRVEARLASGPSLKHFLDEWLSRTPIDGSSEPEGVVGF
LRSYTRSMRQENERRVQMAIDKALTPPDVERLRARYEAESAAAEAFLLAEDDPAADAATR
EKRRAVRAAIVFIESYRELPRLAWPREVLDRILEMEQAMLIWRQRHARMVERVIGRRTGT
GGSAGVDYLDQTALRYRVFGDLWTVRSLLLRKPSVPEIEHASDYGFRVEDSP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacccgtgccaggcccttccgttttctggggggcgggaagtagactcccggcgccg
ctcgtggcgcgggcgcaccgcttgctgcgaacacgccgcgcgaaccccgcccgcggcgcc
tctcgaatcaccaaggacatgaattactgggattacatccacgtcgaggagctgctcgcc
ctccagggtggattcgacgacgacgagcagaaggtcggcaacgacgaggccctgttcatc
gtcgtccatcagatctacgagctctggttcaagctcatcctccgggagctcacctcggcg
cgcgagctcttccgccagaaccccgtgcccgatcagaagctcgcctccgcggcgcgctcg
ttccggcgggtcgtcaccatcttcgagcaggcgatcgagcacttccgggtcatggagacg
ctcacgacccgcgactatctcgatttccgcgatcgcctcatccccgcgagcggcttccag
tcggcgcagctgcgcgagatcgagctcctgctgggcctcgacgacgcgctccggatcccg
ctcggccgggagggcagctacaaggaggcgctgaagaccgcggacggcgcgccctcggcg
gccacgcgccgggtggaggcgaggctcgcgagcgggccgagcctcaagcacttcctggac
gagtggctctcgcggacgccgatcgacggatcgagcgagccggagggcgtcgtgggcttc
ctgcgcagctacacgcgctcgatgcgccaggagaacgagcgccgcgtccagatggcgatc
gacaaggcgctcaccccgccggacgtcgagcggctccgcgcgcgctacgaggcggagagc
gcggccgccgaggcgttcctgctcgccgaggacgatccggcggccgacgcggccacgcgc
gagaagcgccgggcggtccgcgcggcgatcgtcttcatcgagagctaccgcgagctgccc
cgcctcgcgtggccgcgcgaggtgctcgaccgcatcctggagatggagcaggccatgctc
atctggcggcagcgccacgcgcggatggtcgagcgggtgatcggccggcgcaccggcacg
ggcggctccgcgggcgtcgattacctcgaccagaccgcgctgcgctaccgcgtcttcggc
gatctctggacggtgcgctccctgctcttgcgtaagccgagcgtccctgagatcgagcac
gcatcggattacggattccgtgtcgaggactctccgtga

DBGET integrated database retrieval system